Recombinant Mouse C5a anaphylatoxin chemotactic receptor (C5ar1), partial, Biotinylated

In Stock
Code CSB-EP003996MO1-B
Abbreviation Recombinant Mouse C5ar1 protein, partial, Biotinylated
MSDS
Size $308
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
C5a anaphylatoxin chemotactic receptor;C5a-R;C5aR;CD antigen CD88
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
306-351aa
Target Protein Sequence
QGFHGRLLRSLPSIIRNALSEDSVGRDSKTFTPSTTDTSTRKSQAV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
52.8 kDa
Protein Length
Partial
Tag Info
N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a. The ligand interacts with at least two sites on the receptor: a high-affinity site on the extracellular N-terminus, and a second site in the transmembrane region which activates downstream signaling events. Receptor activation stimulates chemotaxis, granule enzyme release, intracellular calcium release and superoxide anion production.
Gene References into Functions
  1. The present study indicates that hBM-MSCs alleviate AKI via suppressing C5a/C5aR-NF-kappaB pathway activation. PMID: 29594894
  2. C5a receptor 1 promotes autoimmunity, neutrophil dysfunction and injury in experimental anti-myeloperoxidase glomerulonephritis. PMID: 29241626
  3. These data indicate that blockade of the C5a-C5aR axis lead to the decreased tissue damage induced by MERS-CoV infection, as manifested by reduced apoptosis and T cell regeneration in the spleen. PMID: 29691378
  4. this study shows that C5a/C5aR pathway accelerates renal ischemia-reperfusion injury by downregulating PGRN expression PMID: 29031143
  5. intracerebral hemorrhage induced complement activation, along with an increase of C5a/C5aR levels, microglia infiltration, and inflammatory cytokine levels. However, C5aR(-/-) mice exhibited significant attenuation of inflammatory reaction, accompanied by a remarkable reduction of Fgl-2, brain water content, and neurological dysfunction. PMID: 27709492
  6. We present evidence that mice deficient in C5aR or treated with AON-D21 are poor hematopoietic stem/progenitor cells mobilizers, thereby establishing a critical role for the C5a/C5adesArg-C5aR axis in the mobilization process. PMID: 28918528
  7. These data are consistent with microglial polarization in the absence of C5aR1 signaling reflecting decreased induction of inflammatory genes and enhancement of degradation/clearance pathways PMID: 28923083
  8. C5aR1 facilities the pathogenesis of chronic kidney infection by enhancement of bacterial colonization of tubular epithelium, promotion of local inflammatory responses, and impairment of phagocytic function of monocytes/macrophages. PMID: 27370410
  9. Data indicate that complement component 5a receptor 1 protein (C5aR1) signaling in osteoblasts plays a detrimental role in bone regeneration after fracture. PMID: 28614388
  10. The role of C5aR1 and C5aR2 in response to renal ischemia-reperfusion injury is reported. The results also demonstrated that C5aR2 is a functional receptor, rather than a decoy receptor, and may provide a new target for intervention. PMID: 28396344
  11. these data reveal a differential role for C5aR during ethanol-induced liver inflammation and injury PMID: 27280845
  12. This work demonstrates mechanisms through which dysregulation of complement causes developmental disease and highlights the potential risk of complement inhibition for therapeutic purposes in pregnancy. PMID: 28455369
  13. These findings demonstrate a complex regulation pattern of C5aR1 in the airways, lung tissue and mediastinal lymph nodes of mice, suggesting that the C5a/C5aR1 axis controls airway constriction and inflammation through activation of myeloid cells in all three compartments in an experimental model of allergic asthma. PMID: 28231307
  14. C5aR1-KO mice exhibited less renal injury, as evidenced by reduced albuminuria. In contrast, cardiac injury was accelerated with increased cardiac fibrosis and heart weight in C5aR1-deficient mice after ANG II infusion. No effect was found on blood pressure. the C5a:C5aR1 axis drives end-organ damage in the kidney but protects from the development of cardiac fibrosis and hypertrophy in experimental hypertension. PMID: 27053686
  15. This study demonstrated that C5aR1 contributes to the acute inflammatory response elicited by infiltrating immune cells following pilocarpine status epilepticus. PMID: 28225153
  16. Regulation of complement 5a receptor (C5aR)-induced neutrophil chemotaxis via IgG1 immune complexes (ICs) depends on galectin-3. PMID: 27620493
  17. The C5a/C5aR pathway is essential for up-regulating SphK1 expression through p38 MAPK activation in acute liver failure.in mice. PMID: 28028363
  18. C5a bidirectionally amplifies TLR4-mediated NLRP3 inflammasome activation in monocytes while suppressing this pathway in macrophages. However, as C5aR1 deficiency attenuates the IL-1beta response to LPS challenge in vivo, results suggest overall that C5a augments physiologic inflammasome responses. PMID: 27382187
  19. CYP4F18-deficient neutrophils exhibit increased chemotaxis to complement component C5a. PMID: 26613087
  20. Blockade of the complement cascade at the C5a/C5a receptor-axis is an efficient treatment mode in a rheumatoid arthritis murine model. PMID: 25915570
  21. Knockout of the C5aR1 attenuated the effect of beta1-AR in the heart, suggesting an association between the beta1-AR and C5aR1, although further investigation is required to determine if this is a direct or causal association PMID: 26727203
  22. this is the first report of the dynamic interactions of neutrophils with Cryptococcus neoformans, demonstrating a crucial role of C5a-C5aR signaling in neutrophil killing of Cryptococcus neoformans in real time. PMID: 26502909
  23. Data (including data from studies in knockout mice) suggest that C5aR/C5aR (complement C5a/anaphylatoxin C5a Receptor) signaling pathway is involved in neurocognitive injury in uninfected pups induced by malaria in pregnancy. PMID: 26402732
  24. Data indicate that C5ar1 activation plays a role in seizure initiation and severity, as well as neuronal degeneration following status epilepticus. PMID: 25681535
  25. C5aRA inhibited AD in mice, possibly through suppression of the C5aRmediated cascade action of mast cells. PMID: 25650554
  26. identifies a key role for C5aR signaling in astrocyte proliferation and glial scarring during the chronic phase of Spinal Cord Injury. PMID: 25904802
  27. Porphyromonas gingivalis induced C5aR-TLR2 crosstalk leads to MyD88 degradation. PMID: 24922578
  28. Complement receptor C5aR1/CD88 and dipeptidyl peptidase-4/CD26 define distinct hematopoietic lineages of dendritic cells. PMID: 25769922
  29. Deletion of the complement C5a receptor alleviates the severity of acute pneumococcal otitis media following influenza A virus infection in mice. PMID: 24740152
  30. our findings suggest that C5aR1 expression in mice is largely restricted to cells of the myeloid lineage PMID: 25589074
  31. Loss of C5ar1 is associated with atherosclerotic plaques. PMID: 25124749
  32. knock-out dendritic cells fail to induce experimental allergy due to a reduced capability to migrate into the lung tissue and a decreased potency to direct pulmonary homing of effector T cells PMID: 25355927
  33. Pharmacologic blockade of C5aR by a low molecular weight antagonist (PMX205) reduces airway inflammatory. PMID: 24859057
  34. TNF-alpha, and FGL2 form an integral network that contributes to coagulation and complement activation, and suggest that those are potential therapeutic targets in viral FH intervention. PMID: 25200905
  35. Findings demonstrate that, under excitotoxicity, Fosb products contribute to a neuroinflammatory response in the hippocampus through regulation of microglial C5ar1 and C5ar2 expression PMID: 24771617
  36. This work reveals an essential role for C5L2 in C5a-triggered, AP2-dependent C5aR internalization and downstream ERK signaling. PMID: 24631530
  37. C5aR signaling promoted Treg generation and suppressed T-cell responses in organs where metastases arose. PMID: 24786787
  38. findings demonstrated that complement C5aR is detrimental to histological and functional locomotor recovery at the early stage of secondary injury after spinal cord injury PMID: 24607885
  39. These observations indicate the importance of C5aR in adipose tissue metabolism and immunity, which may be regulated through heterodimerization with C5L2. PMID: 24397921
  40. Collectively, these data indicate that biliverdin regulates LPS-mediated expression of C5aR via the mTOR pathway, revealing an additional mechanism underlying biliverdin's anti-inflammatory effects. PMID: 24814708
  41. Complement is activated in hypertensive hearts, and the C5aR signaling pathway on blood monocytes/macrophages plays a pathological role in angiotensin II-induced cardiac inflammation and remodeling PMID: 24743429
  42. role in myocardial ischemia with reperfusion injury due to effect on leukocyte transmigration across inflamed endothelium into the ischemic myocardium PMID: 23642836
  43. C5a receptor signalling in dendritic cells controls the development of maladaptive Th2 and Th17 immunity in experimental allergic asthma. PMID: 23212198
  44. a role (either direct or indirect) for C5aR in energy expenditure and fat storage PMID: 23667486
  45. Inhibiting signaling of the complement component C5a receptor (C5aR) altered the composition and diversity of the skin microbiota as revealed by deep sequencing of the bacterial 16S rRNA gene. PMID: 23980152
  46. These results suggest that C5aR contributes to macrophage accumulation and M1 polarization in the obese adipose tissue and thereby to adipose tissue dysfunction and development of adipose tissue insulin resistance. PMID: 24043887
  47. Protective efficacy against Plasmodium yoelii 17XL vaccine challenge is considerably reduced, and malaria-specific CD4+ T cell activation and memory T cell differentiation are largely suppressed in C5aR-deficient mice. PMID: 23709683
  48. Estradiol may differentially modulate C5a-induced calcium influx in neuron calcium channels depending on the expression of the two estrogen receptor isotypes. PMID: 22406418
  49. C5a receptor signaling prevents folate deficiency-induced neural tube defects in mice. PMID: 23420882
  50. The exaggerated humoral immune response in CFH(-/-) mice was normalized in CFH(-/-)C5aR(-/-) double knockout mice, highlighting the C5aR dependence. PMID: 22832515

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*