Recombinant Mouse Desert hedgehog protein (Dhh), partial

Code CSB-YP720251MO
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP720251MO-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP720251MO
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP720251MO
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
DhhDesert hedgehog protein; DHH; HHG-3) [Cleaved into: Desert hedgehog protein N-product; Desert hedgehog protein C-product]
Species
Mus musculus (Mouse)
Expression Region
23-198aa
Target Protein Sequence
CGPGRGPVGRRRYVRKQLVPLLYKQFVPSMPERTLGASGPAEGRVTRGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHIHVSVKADNSLAVRAGG
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Intercellular signal essential for a variety of patterning events during development. May function as a spermatocyte survival factor in the testes. Essential for testes development.
Gene References into Functions
  1. the critical role of Dhh in maintaining blood nerve barrier integrity and demonstrates for the first time that endothelial dysfunction is sufficient to induce neuropathy PMID: 26645982
  2. In organogenesis of the ovary, production of Dhh/Ihh in granulosa cells requires growth differentiation factor 9 from the oocyte. PMID: 25917826
  3. increased expression in cell bodies of cutaneous sensory nerves of dorsal root ganglia as compared with skin epithelia PMID: 25842978
  4. The results demonstrate a pivotal role for dhh in maintof this study aining myelination. Furthermore, dhh signaling reveals a potential target for therapeutic intervention to prevent and treat demyelination of peripheral nerves in compression neuropathies PMID: 25936873
  5. Hedgehog signaling is impaired in aged mice. Hegdehog-dependent regulation of angiogenesis and myogenesis involves distinct mechanisms. PMID: 24135022
  6. Data indicate that the centrosomal protein DZIP1 interacts with GLI3 transcription factor in the cytoplasm and regulates Hedgehog signaling and ciliogenesis. PMID: 23955340
  7. Desert hedgehog promotes ischemia-induced angiogenesis by ensuring peripheral nerve survival. PMID: 23343527
  8. Desert hedgehog-dependent transcription in T cells promotes T helper (Th)2 cell transcriptional programs and differentiation, exacerbating allergic disease. PMID: 23408837
  9. During recovery of hematopoiesis after irradiation, and under conditions of stress-induced erythropoiesis, erythrocyte differentiation was accelerated in both spleen and bone marrow of Dhh-deficient mice compared with wild type. PMID: 22461491
  10. The findings suggest that Sertoli cells coordinate Dhh-dependent spermatogenesis events via Ptc1 and Smo prior to the first meiotic division and in postmeiotic (haploid) cells, particularly during the first half of spermiogenesis. PMID: 19484749
  11. Desert Hedgehog/Patched 1 signaling specifies fetal Leydig cell fate in testis organogenesis PMID: 12050120
  12. transgenic skin developed lesions reminiscent of human basal cell carcinoma PMID: 15371305
  13. Prominent role of hedgehog signaling in the communication between granulosa cells and developing theca cells. PMID: 15878962
  14. A single identified glial signal, desert hedgehog, plays a critical role in controlling the integrity of peripheral nervous tissue, in line with its critical role in nerve sheath development. PMID: 16763045
  15. results demonstrate a functional desert hedgehog(HH) pathway in the follicle and identify granulosa cells as at least one of the potential targets of HH signaling PMID: 17392501
  16. combinatorial expression of the paracrine factor Dhh and nuclear transcription factor Sf1 is required for Leydig cell development PMID: 17495005
  17. Inactivation of Nf1 in the glial lineage in vitro at embryonic day 12.5 + 1, but not earlier (neural crest) or later (mature Schwann cell), results in colony-forming cells capable of multilineage differentiation. PMID: 18242511

Show More

Hide All

Subcellular Location
[Desert hedgehog protein N-product]: Cell membrane; Lipid-anchor; Extracellular side.; [Desert hedgehog protein C-product]: Secreted, extracellular space.
Protein Families
Hedgehog family
Tissue Specificity
Expressed in adult testes. Not expressed in limb buds.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1