Recombinant Mouse Epithelial cell adhesion molecule (Epcam), partial

In Stock
Code CSB-MP007717MOb1
Abbreviation Recombinant Mouse Epcam protein, partial
MSDS
Size $102
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
cell-cell adhesion
Alternative Names
Epithelial glycoprotein 314 Short name: EGP314 Short name: mEGP314 Protein 289A Tumor-associated calcium signal transducer 1 CD_antigen: CD326
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
24-266aa
Target Protein Sequence
QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.7 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.
Gene References into Functions
  1. The expression of Epcam mRNA, which is a functional marker of potential hepatic stem-like cells, was controlled by LEF1, which was regulated by CLOCK. PMID: 29958886
  2. EpEX/EpCAM are sufficient to reprogram fibroblasts into iPSCs with only Oct4 or Klf4. PMID: 28157205
  3. extracellular vesicles tend to localize in the intestinal tract associated with epithelial cell adhesion molecule PMID: 27721471
  4. Data show that EpCAM-expressing proliferating ductal cells (PDC) could be a cellular origin of hepatocellular carcinoma (HCC), suggesting the existence of stem/progenitor-derived hepatocarcinogenesis. PMID: 28951464
  5. activation of hepatic H19RNA promoted cholestatic liver fibrosis through the ZEB1/EpCAM signaling pathway PMID: 28407375
  6. These results identify EpCAM as a substrate of matriptase and link HAI-2, matriptase, EpCAM, and claudin-7 in a functionally important pathway that causes disease when it is dysregulated. PMID: 28094766
  7. EpCAM appears to differentially regulate Langerhans cell mobility/migration in the setting of limited inflammation as compared with the intense inflammation triggered by contact sensitizers PMID: 27106675
  8. Knock-down EpCAM cell model of congenital tufting enteropathy was developed. In vivo inducible mouse model was developed resulting in mutant EpCAM protein. PMID: 25482158
  9. in addition to converting to cholangiocyte-like cells, Sox9(+)EpCAM(-) cells provide luminal space near expanded ductular structures to prevent deterioration of the injuries and potentially supply new hepatocytes to repair damaged tissues PMID: 24482234
  10. EpCAM is a highly conserved protein present in fishes, amphibians, reptiles, birds, marsupials, and placental mammals, and is subject to shedding, gamma-secretase-dependent regulated intramembrane proteolysis, and proteasome-mediated degradation. PMID: 24009667
  11. Suggest pivotal role of EpCAM in intestinal epithelial structure and integrity, with mutations resulting in congenital tufting enteropathy. PMID: 24337010
  12. mTrop1/Epcam knockout mice develop congenital tufting enteropathy through dysregulation of intestinal E-cadherin/beta-catenin. PMID: 23209569
  13. EpCAM contributes to formation of intestinal barrier by recruiting claudins to cell-cell junctions. PMID: 22819673
  14. These results conclusively link EpCAM expression to Langerhan cell (LC) motility/migration and LC migration to immune regulation. PMID: 22411813
  15. Results show that SSCs are the most concentrated in CD9(+)EPCAM(low/-) population and also suggest that EPCAM plays an important role in progenitor cell amplification in the mouse spermatogenic system. PMID: 21858196
  16. EpCAM could contribute substantially to the pathogenesis of lung cancer. PMID: 21535318
  17. EpCAM was required for differentiation or survival of parietal trophoblast giant cells, normal development of the placental labyrinth and establishment of a competent maternal-fetal circulation. PMID: 20046825
  18. analysis of EpCAM expression in normal, non-pathological tissues PMID: 17981779
  19. The spatiotemporal expression pattern of EpCAM changes during nephrogenesis PMID: 18025791
  20. These data suggest that EpCAM is involved in signal transduction triggering several intracellular signalling pathways using tumor cell lines in colorectal and lung cancer. PMID: 19002182
  21. EpCAM(+) cells isolated from injured liver proliferate to form colonies in vitro, and the clonally expanded cells differentiate into hepatocytes and cholangiocytes, suggesting that the oval cell fraction contains potential HSCs. PMID: 19429791
  22. expression of EpCAM and DLK1 suggests the developmental pathways of mouse liver progenitors PMID: 19527784

Show More

Hide All

Subcellular Location
Lateral cell membrane; Single-pass type I membrane protein. Cell junction, tight junction.
Protein Families
EPCAM family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*