Recombinant Mouse Estrogen receptor (Esr1),Biotinylated

Code CSB-EP007830MO-B
MSDS
Size $554
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Esr1
Uniprot No.
Research Area
Cancer
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-599aa
Target Protein Sequence
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPTVFNYPEGAAYEFNAAAAAAAAASAPVYGQSGIAYGPGSEAAAFSANSLGAFPQLNSVSPSPLMLLHPPPQLSPFLHPHGQQVPYYLENEPSAYAVRDTGPPAFYRSNSDNRRQNGRERLSSSNEKGNMIMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNEMGASGDMRAANLWPSPLVIKHTKKNSPALSLTADQMVSALLDAEPPMIYSEYDPSRPFSEASMMGLLTNLADRELVHMINWAKRVPGFGDLNLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVPLYDLLLEMLDAHRLHAPASRMGVPPEEPSQTQLATTSSTSAHSLQTYYIPPEAEGFPNTI
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
114.7 kDa
Protein Length
Full Length
Tag Info
N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Ligand-dependent nuclear transactivation involves either direct homodimer binding to a palindromic estrogen response element (ERE) sequence or association with other DNA-binding transcription factors, such as AP-1/c-Jun, c-Fos, ATF-2, Sp1 and Sp3, to mediate ERE-independent signaling. Ligand binding induces a conformational change allowing subsequent or combinatorial association with multiprotein coactivator complexes through LXXLL motifs of their respective components. Mutual transrepression occurs between the estrogen receptor (ER) and NF-kappa-B in a cell-type specific manner. Decreases NF-kappa-B DNA-binding activity and inhibits NF-kappa-B-mediated transcription from the IL6 promoter and displace RELA/p65 and associated coregulators from the promoter. Recruited to the NF-kappa-B response element of the CCL2 and IL8 promoters and can displace CREBBP. Present with NF-kappa-B components RELA/p65 and NFKB1/p50 on ERE sequences. Can also act synergistically with NF-kappa-B to activate transcription involving respective recruitment adjacent response elements; the function involves CREBBP. Can activate the transcriptional activity of TFF1. Also mediates membrane-initiated estrogen signaling involving various kinase cascades. Essential for MTA1-mediated transcriptional regulation of BRCA1 and BCAS3.
Gene References into Functions
  1. The authors identify estrogen receptor alpha (ERalpha) as the top regulator of pro-resilient transcriptional changes in the nucleus accumbens, a key brain reward region implicated in depression. PMID: 29549264
  2. ERalpha-signaling may be crucial for vibration-induced effects on fracture healing, whereas ERbeta-signaling may play a minor role PMID: 29367057
  3. hepatic Estradiol/ESR1 signaling plays a key role in the maintenance of gluconeogenesis and lipid metabolism in males. PMID: 28490809
  4. ESR1 inhibits chorionic gonadotropin-induced steroidogenesis and proliferation of progenitor Leydig cells in mice. PMID: 28266530
  5. suppresses breast cancer metastasis by regulating vinculin PMID: 28266545
  6. High ESR1 expression is associated with metastasis in breast Cancer. PMID: 29187405
  7. Study demonstrates an unexpected phenotype in high fat diet-fed estrogen receptor alpha (ERalpha) knockout mice involving severe uterine bacterial infections likely resulting from a previously unknown negative interference between dietary fatty acids and ERalpha-signaling during anti-microbial defence. PMID: 28233809
  8. study found that 27-HC promoted the growth of melanoma cells by activating ERalpha and eliciting the AKT and MAPK signaling pathway. PMID: 29130512
  9. By using mutant mice with liver-specific ablation of Eralpha, the authors here demonstrate that the hepatic ERalpha is essential for the modulation of the activity of Agouti Related Protein (AgRP) neurons in relation to the reproductive cycle and diet. PMID: 28446774
  10. DNA methylation and transcriptome aberrations mediated by ERalpha in mouse seminal vesicles following developmental DES exposure. PMID: 29666266
  11. This novel transgenic mouse line will be a useful animal model for lineage-tracing Esr1-expressing cells, selective gene ablation in the Esr1-lineage cells and for generating global Esr1 knockout mice. PMID: 29115049
  12. Data (including data from studies in transgenic mice) suggest that Esr1 signaling promotes activation of Pp2a; here, central activation of Pp2a during estrogen replacement therapy is involved in prevention of menopause-induced obesity and glucose intolerance (that is, induced by lack of membrane-initiated Esr1 signaling). (Esr1 = estrogen receptor 1; Pp2a = protein phosphatase 2A) PMID: 29764860
  13. Results show that membrane initiated ERalpha signaling is important for the estrogen response in adult female mice in vivo in a tissue-dependent manner, and that membrane ERalpha signaling is crucial for the estrogen response in trabecular bone in the axial skeleton. PMID: 27388455
  14. Results show that ERalpha activation might constitute one of the neural substrate that is involved involved in the facilitative mechanisms to restore the sexual olfactory preferences of sexually naive Tph2-/- female mice. PMID: 29470551
  15. Study found that estrogen receptor alpha (ERalpha) was expressed in the motoneurons of lumbar ventral horn. ERalpha and ERbeta were mainly localized in the nuclei of motoneurons with less immunoreactivity in the cytoplasm. PMID: 28501695
  16. suggest miR-181a inhibition enhances E2-mediated stroke protection in females in part by augmenting ERalpha production PMID: 28522364
  17. nuclear Shp2, rather than cytosolic Shp2, promotes the ERalpha transcription activity. This function is achieved by enhancing the Src kinase-mediated ERalpha tyrosine phosphorylation, which facilitates ERalpha binding to Pgr promoter in an ERK-independent manner in periimplantation uteri. PMID: 28424251
  18. ERalpha masculinizes GABAergic neurons that gate the display of male-typical behaviors. PMID: 28734725
  19. The administration of ICI182,780, which is an agonist of G-protein coupled estrogen receptor (GPER) and an antagonist of ERa and ERb, did not result in protection; however, ICI182,780 significantly blocked EDC-mediated cardioprotection, indicating participation of ERalpha and/or ERbeta PMID: 28457941
  20. Data (including data from studies using knockout mice) suggest that early initiation of endometriosis is predominantly dependent on immune system; cross-talk occurs between Esr1 and Il6 pathways during early initiation of endometriosis lesion development; estradiol stimulation of Esr1 appears to play minor role in early lesion development. (Esr1 = estrogen receptor alpha; Il6 = interleukin 6) PMID: 28927243
  21. Studies indicate that lack of estrogen receptor alpha (ERalpha) in osteoblast progenitor and precursor cells generally affects the periosteum of female and male mice. PMID: 29148577
  22. extra-nuclear estrogen signaling affects cortical bone mass in males, and this effect is dependent on a functional ERalphaAF-1. PMID: 28057769
  23. Transgenic mouse line expressing the human Ki-Ras bearing an activating mutation (Ki-Ras((G12V))) selectively in the mammary epithelium develop estrogen receptor alpha (ERalpha)-positive ductal adenocarcinomas with 100% incidence within 3-9 months after Ki-Ras((G12V)) induction. PMID: 28745321
  24. mouse mammary ER(+) and ER(-) luminal cells are two independent lineages that are maintained by distinct stem cells, providing a revised mammary epithelial cell hierarchy. PMID: 28329676
  25. Lupus-prone ERalpha -/- mice are not protected from lupus disease expression if ovariectomized. PMID: 28822833
  26. Taken together, the above results clearly demonstrated an mTORC2-dependent regulation of actin polymerization that contributed to the effects of ERalpha and ERbeta on spatial learning, which may provide a novel target for the prevention and treatment of E2-related dementia in the aged population PMID: 28789972
  27. These findings suggest that RASD1 acts as a novel signaling molecule and plays an important role in regulating dynamic uterine remodeling during the estrous cycle in the uterus. PMID: 28188843
  28. Truncating mutations of Prlr promote tumor growth in a model of human ERalpha+ breast cancer. PMID: 27681435
  29. This comparative study documented the complexity of ERalpha genes, mRNAs, and proteins, and further determined the underlying structural basis of ligand-independent activation by C-terminally-truncated ERalpha variants. PMID: 28412386
  30. E2-ERs system was functional in maintaining oocyte meiotic arrest by regulating the expression of natriuretic peptide C and natriuretic peptide receptor 2 (NPPC/NPR2) PMID: 28277543
  31. Ventromedial hypothalamus neurons expressing Esr1 are indispensable for female aggression. PMID: 28920934
  32. Increased DNA methylation accompanied this pattern, particularly at CpG dinucleotides located within binding or flanking regions for the transcriptional regulator CCCTC-binding factor of ESR1 and ESR2, consistent with sustained transcriptional activation of ERa and ERb PMID: 28373182
  33. Ciliary length and beat frequency of the oviductal epithelial cells are regulated through ESR1. PMID: 28082352
  34. Loss of endothelial ERalpha reduces vascular stiffness in male mice fed a Western Diet with an associated outward hypertrophic remodeling of resistance arteries. PMID: 28430983
  35. results also suggest that, in the presence of adult endogenous steroid levels, ERalpha36 overexpression in vivo contributes to alter mammary gland architecture which may support pre-neoplastic lesion and augment breast cancer risk PMID: 28301550
  36. Activation of HIF1A by prolonged in vivo hyperinsulinemia potentiates cancerous progression in estrogen receptor-positive breast cancer cells. PMID: 28351619
  37. Gene-environment interactions driven by early life xenoestrogen exposure likely contributes to increased risk of estrogen-related disease in adults. PMID: 27312807
  38. activation in the medial amygdala during the pubertal period is crucial for male mice to fully express their male-type social behaviors in adulthood PMID: 27325769
  39. Data suggest that prenatal exposure to p,p'-DDT (an endocrine disrupting pesticide) causes sex- and age-independent attenuation of Esr1 in brain which may be involved in propagation of DDT-induced depressive-like neurotoxicity. PMID: 28263910
  40. Here, the authors demonstrate that mature miRNA-22 is more abundant in muscle from male mice relative to females and that this enables sex-specific regulation of muscular lipid metabolism and body weight by repressing estrogen receptor alpha (ERalpha) expression. PMID: 28314781
  41. Estrogen response element-independent regulation in the arcuate nucleus is mainly mediated by tethering of ERalpha. PMID: 28359086
  42. ERalpha acts in a B cell-intrinsic manner to control B cell activation, autoantibody production, and lupus nephritis PMID: 27989899
  43. These findings identify a previously unknown role for membrane ESR1 in the development of normal sperm and providing an adequate environment for spermatogenesis. PMID: 27145009
  44. The present results showed that ER knockout alpha and beta male mice had lower striatal mGlu5 receptor binding and protein measured by Western blot. PMID: 26873133
  45. However, the SERMs had slightly different effects on the appendicular skeleton since only Las increased the trabecular bone mass and only Ral increased the cortical porosity. Importantly, all SERM effects require a functional ERalphaAF-1 in female mice. These results could lead to development of more specific treatments for osteoporosis. PMID: 27048997
  46. Kiss1 in the medial amygdala is regulated primarily by estrogen receptor alpha, and not estrogen receptor beta. PMID: 27564649
  47. The balance between inhibitory effects of central ERalpha activity in hypothalamic POMC neurons in arcuate nucleus of the hypothalamus and stimulatory peripheral ERalpha-mediated effects in bone determines cortical bone mass in female mice. PMID: 27254004
  48. we found that post-ejaculated semen from fertile wild-type males was solidified and the sperm were entrapped in Wnt7aCre/+;Esr1f/f uteri, compared to the watery semen (liquefied) found in Esr1f/f controls.Kallikrein-related peptidases 3 (KLK3) and other kallikrein-related peptidases from male prostate glands are responsible for semen liquefaction by cleaving gel-forming proteins PMID: 28414719
  49. we showed that, in the absence of ERalpha, G93A-SOD1 failed to activate OMI and the proteasome, confirming the ERalpha dependence of the response. Taken together, these results demonstrate the IMS-UPRmt activation in SOD1 familial Amyotrophic lateral sclerosis , and suggest that sex differences in the disease phenotype could be linked to differential activation of the ERa axis of the IMS-UPRmt PMID: 28186560
  50. Here we describe the generation of a gene-targeted mouse line that enables CRE-inducible expression of a conditionally-active fusion between the ROCK2 kinase domain and the hormone-binding domain of a mutated estrogen receptor (ROCK2:ER). This two-stage system of regulation allows for tissue-selective expression of the ROCK2:ER fusion protein, which then requires administration of estrogen analogues PMID: 27775859

Show More

Hide All

Subcellular Location
Nucleus. Cytoplasm. Golgi apparatus. Cell membrane.
Protein Families
Nuclear hormone receptor family, NR3 subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*