Recombinant Mouse Fibroblast growth factor 1 (Fgf1)

Code CSB-YP008615MO
Abbreviation Recombinant Mouse Fgf1 protein
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Acidic fibroblast growth factor;Heparin-binding growth factor 1
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
16-155aa
Target Protein Sequence
FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrin ITGAV:ITGB3. Its binding to integrin, subsequent ternary complex formation with integrin and FGFR1, and the recruitment of PTPN11 to the complex are essential for FGF1 signaling. Induces the phosphorylation and activation of FGFR1, FRS2, MAPK3/ERK1, MAPK1/ERK2 and AKT1. Can induce angiogenesis.
Gene References into Functions
  1. The present results provided evidence that aFGF accelerates the progression of atherosclerosis and suggested that aFGF may be a potential therapeutic target for the prevention of atherosclerosis development. PMID: 29845277
  2. TUG1 knockdown ameliorates atherosclerosis by modulating FGF1 via miR-133a in ApoE knockout mice. PMID: 29268138
  3. Fibroblast growth factor (FGF1 and FGF2), but not vascular endothelial growth factor (VEGF) rescued Psen1-/- cells from serum starvation induced apoptosis.In the absence of serum, FGF2 immunoreactivity was distributed diffusely in cytoplasmic and nuclear vesicles of wt and Psen1-/- cells, as levels of FGF2 in nuclear and cytosolic fractions were not significantly different. PMID: 27443835
  4. Suboptimal FGFR activation by a weak FGF1-FGFR dimer is sufficient to evoke a metabolic response, whereas full FGFR activation by stable and sustained dimerization is required to elicit a mitogenic response. PMID: 28813681
  5. FGF1 protects neuroblastoma cells from p53-dependent apoptosis through an intracrine pathway regulated by FGF1 phosphorylation. PMID: 29048426
  6. the HDAC3-N-CoR corepressor complex leaves the Fgf1b promoter and a complex involving the translocated CRTC1, phosphorylated CREB, and histone acetyltransferase CBP induces transient transcription. PMID: 28076781
  7. lncRNA-Map2k4 is the target gene of miR-199a, and its down-regulation promotes miR-199a expression in neurons. miR-199a targeted regulation of FGF1 expression in neurons. PMID: 28655615
  8. clearly demonstrate the different specificity of FGF12-FGFR1c2 and FGF22-FGFR1c2 for well defined HS structures and suggest that it is now possible to chemoenzymatically synthesize precise HS polysaccharides that can selectively mediate growth factor signaling PMID: 28031461
  9. The study supports a pro-adipogenic role for betaKlotho in skeletal muscle fibro/adipogenesis and calls for further research on involvement of the FGF-FGFR-betaKlotho axis in the fibro/adipogenic infiltration associated with functional deterioration of skeletal muscle in aging and muscular dystrophy. PMID: 26881702
  10. fibroblast growth factor 1 (FGF1) to be synergistically induced by heat shock and wounding. PMID: 27638903
  11. Data suggest that Fgf1-mediated signaling represents an important signaling cascade related to adipogenesis and visceral adiposity; expression of Fgf1 (fibroblast growth factor 1) and Fgfr1 (fibroblast growth factor receptor 1) is up-regulated in adipose tissue of obese mice (both obese mice due to high-fat diet and obese mice due to genetic deletion of leptin). PMID: 26847131
  12. These results suggest that FGFs promote hair growth by inducing the anagen phase in resting hair follicles and might be a potential hair growth-promoting agent. PMID: 25685806
  13. Study presents a transcript profiling of remyelinated multiple sclerosis lesions and identified FGF1 as a promoter of remyelination PMID: 25589163
  14. Nucleolin-FGF1 interaction is critical for the intranuclear phosphorylation of FGF1 by PKCdelta and thereby the regulation of nuclear export of FGF1. PMID: 24595027
  15. parenteral delivery of a single dose of recombinant FGF1 (rFGF1) results in potent, insulin-dependent lowering of glucose levels in diabetic mice that is dose-dependent but does not lead to hypoglycaemia PMID: 25043058
  16. Although FGF1 transgenic mice had a normal phenotype with unperturbed kidney structure, they showed a severely inhibited kidney repair after unilateral ischemia/reperfusion. This was manifested by a strong decrease of postischemic kidney size and weight. PMID: 22606265
  17. RA via RALDH2 has separable functions in the developing spinal cord to (i) maintain high levels of FGF and Notch signaling and (ii) drive stem cell differentiation, thus restricting both the numbers and the pluripotent character of neural stem cells PMID: 22396766
  18. discovery of a phenotype for the FGF1 knockout mouse establishes the PPARgamma-FGF1 axis as critical for maintaining metabolic homeostasis and insulin sensitization PMID: 22522926
  19. The results demonstrate that the FGF1/FGFR1 complex constitutes a signalling module that independently of the receptor tyrosine kinase can convey a signal that initiates a strictly timed and periodic release of endocytosed FGF1 into the cytosol/nucleus. PMID: 21223966
  20. RFX1 may negatively regulate the self-renewal of GBM-SCs through modulating FGF-1B and FGF1 expression levels by binding the 18-bp cis-elements of the F1B promoter. PMID: 20189986
  21. the neuroprotective effects of FGF1 involve inactivation of GSK3beta PMID: 12095987
  22. FGF-1, FGF-2 and FGF receptor-1 levels in the cochlear nucleus following acoustic overstimulation PMID: 12121735
  23. the depletion of FGF1 may be a key regulatory component in initial phase of branching morphogenesis of the lung bud epithelium in vitro PMID: 12128203
  24. Agonist role for FGF1 and FGF2 in specifically insult-induced liver matrix deposition and hepatic fibrogenesis and a potential target for the prevention of hepatic fibrosis. PMID: 14507672
  25. non-classical release is mediated by synaptotagmin 1 PMID: 14559220
  26. High steady-state levels of ONOO(-) may induce cysteine oxidation, tyrosine nitration, and non-nreversible inactivation of FGF-1, a inhibitory feedback mechanism restoring cellular homeostatis during resolution of inflammation and repair. PMID: 14592461
  27. Gab1 is essential for FGF1 stimulation of both PI 3-kinase and the antiapoptotic protein kinase Akt, while FGF1-induced MAPK stimulation is not affected by Gab1 deficiency. PMID: 15199124
  28. Data show that mouse and human fibroblast growth factor 1 (FGF-1) internal ribosome entry sites show similar activity profiles, and have a conserved structural domain at both the nucleotide sequence and RNA structure levels. PMID: 15314170
  29. Phosphorylation of Fgf1 occurs in the nucleus by pkcdelta. It is then exported to the cytosol. PMID: 15574884
  30. Hsp90 is required for translocation of FGF-1 and FGF-2 across the endosomal membrane PMID: 16495214
  31. FGF7- and FGF1-induced mitogenesis and downstream signaling is controlled by distinct heparin octasaccharide motifs PMID: 16728399
  32. FGF1 and p40 synaptotagmin 1 release correlates with membrane destabilizing ability PMID: 16930531
  33. These results identify a novel aspect of the crosstalk between FGF and thrombin signaling pathways which both play important roles in tissue repair and angiogenesis. PMID: 17027650
  34. Shisa is antagonistic to Wnt and Fgf signalings PMID: 17481602
  35. In apoE-deficient mouse astrocytes, FGF-1 stimulated cholesterol biosynthesis without enhancing its release, indicating a signaling pathway independent of apoE biosynthesis upregulation. PMID: 17548887
  36. Formation of the FGF-1-exportin-1-Ran-GTP complex in vitro as well as nuclear export of FGF-1 in vivo was dependent on phosphorylation of FGF-1, and it was abolished by leptomycin B. PMID: 17616529
  37. sphingosine kinase 1 is a component of the copper-dependent FGF1 release pathway. PMID: 17643421
  38. A conserved, specific and stage-dependent requirement for Erk1/2 signalling downstream of FGF-induced neural specification in higher vertebrates. PMID: 17660197
  39. FGF and PDGF have roles in cell proliferation and migration in osteoblastic cells PMID: 17852407
  40. analysis of expression of bicistronic vector driven by the FGF-1 IRES in mouse muscle PMID: 17963525
  41. 6-O-sulfate in HS may regulate the signalings of some of HB-GFs, including FGF-1, FGF-2 and FGF-4, by inducing different interactions between ligands and their receptors PMID: 18281280
  42. and fibroblast growth factor signaling interact to control the proximal-distal pattern of forming airways in the mammalian lung PMID: 18694942
  43. These data demonstrate the existence of novel cross-talk between thrombin, FGF, and Notch signaling pathways, which play important roles in vascular formation and remodeling. PMID: 18784255
  44. An interplay between retinoic acid, Fgf and Shh signalling is likely to be an important mechanism underpinning the tight regulation of caudal embryonic development. PMID: 19168680
  45. A detailed double-label immunohistochemical investigation of the localization patterns of FGF1 and its receptors FGFR1 and FGFR2 in adult and early postnatal mouse retinas, is reported. PMID: 19408015
  46. Results revealed a mechanism of molecular coupling of mRNA transcription and translation, involving a unique process of IRES activation by a FGF1 promoter element. PMID: 19561198
  47. that the main role of heparin in FGF-induced signaling is to protect this naturally unstable protein against heat and/or proteolytic degradation and heparin is not essential for a direct FGF1-FGFR interaction and receptor activation PMID: 19574212

Show More

Hide All

Subcellular Location
Secreted. Cytoplasm. Cytoplasm, cell cortex. Cytoplasm, cytosol. Nucleus.
Protein Families
Heparin-binding growth factors family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*