Recombinant Mouse Fibroblast growth factor 15 (Fgf15)

In Stock
Code CSB-EP522052MO
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Fgf15
Uniprot No.
Research Area
Signal Transduction
Alternative Names
FGF-15; Fgf15; FGF15_MOUSE; FGF19; Fibroblast growth factor 15
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
26-218aa
Target Protein Sequence
RPLAQQSQSVSDEDPLFLYGWGKITRLQYLYSAGPYVSNCFLRIRSDGSVDCEEDQNERNLLEFRAVALKTIAIKDVSSVRYLCMSADGKIYGLIRYSEEDCTFREEMDCLGYNQYRSMKHHLHIIFIQAKPREQLQDQKPSNFIPVFHRSFFETGDQLRSKMFSLPLESDSMDPFRMVEDVDHLVKSPSFQK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
38.5kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Enhance your signal transduction research with our Recombinant Mouse Fgf15, also known as Fibroblast growth factor 15. This protein, produced in E.coli, is instrumental in illuminating the intricate pathways of cellular communication and growth.

Offered as a full-length mature protein (26-218aa), our Fgf15 ensures a comprehensive understanding of its function and structure. The protein is expressed with a N-terminal 6xHis-SUMO tag, providing efficient purification and robust stability. Our Recombinant Mouse Fgf15, with a purity of over 90% as determined by SDS-PAGE, meets the exacting standards of scientific research. Choose between liquid form for immediate use or lyophilized powder for extended storage, adapting to your research workflow.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression.
Gene References into Functions
  1. Taken together, these results suggested that FGF19, through the anti-oxidative defense system, attenuated the development of diabetic cardiomyopathy and restored cardiac function. PMID: 29778534
  2. ileal FGF15/19 to hepatic FGFR4 axis is activated and promotes liver regeneration (LR) after partial hepatectomy (PH) in mice, supporting the potential of ileal FGF15/19 to hepatic FGFR4 axis-targeted therapy to enhance LR after PH PMID: 29468415
  3. FRS2alpha-mediated pathways are essential for the FGF15/FGF19-FGFR4 signaling axis to control bile acid homeostasis. PMID: 25056539
  4. Together, our results show that SuFu promotes cerebellar radial precursor differentiation to neurons. SuFu function is mediated in part by GLI3R and down-regulation of Fgf15 expression. PMID: 28560839
  5. Results show a reciprocal regulation of adiponectin and FGF19 gene expression in mice. PMID: 27666676
  6. Tumorigenicity was assessed in three mouse models (db/db, diet-induced obese, and multi-drug resistance 2 [Mdr2]-deficient) following continuous exposure to FGF19 or FGF15 via adeno-associated viral-mediated gene delivery. PMID: 28189755
  7. These data identify hypothalamic Fgf15 as a regulator of glucagon secretion. PMID: 27829151
  8. Intestinal sensing of highly elevated levels of conjugated bile acids in blood promotes FGF15 signaling, reducing hepatic bile acid synthesis and modulating bile acid transporters. PMID: 28498614
  9. Fgf15 is the sonic hedgehog downstream signal to control thalamic regionalization, neurogenesis, and neuronal differentiation by regulating the expression and mutual segregation of neurogenic and proneural regulatory genes. PMID: 26311466
  10. human microbiota was able to reduce the levels of tauro-beta-muricholic acid and induce expression of FXR target genes Fgf15 and Shp in ileum after long-term colonization. We show that a human microbiota can change BA composition and induce FXR signaling in colonized mice, but the levels of secondary BAs produced are lower than in mice colonized with a mouse microbiota PMID: 27956475
  11. FGF15 improves lipid homeostasis and reduces bile acid synthesis, but promotes fibrosis during the development of non-alcoholic steatohepatitis PMID: 28673684
  12. This study demonstrates that the FGF19-SHP-LSD1 axis maintains homeostasis by suppressing unnecessary autophagic breakdown of cellular components, including lipids, under nutrient-rich postprandial conditions. PMID: 28446510
  13. The elevation in circulating levels of adiponectin and Fgf15 led to normalized hepatic and serum levels of bile acids, limited hepatic accumulation of toxic bile, attenuated inflammation, and amelioration of liver injury in the ethanol-fed mNT knockout mice. PMID: 27573244
  14. This study reveals SHP as a global transcriptional partner of SREBP-2 in regulation of sterol biosynthetic gene networks and provides a potential mechanism for cholesterol-lowering action of FGF19. PMID: 26634251
  15. we suggest that considerable mechanistic differences exist between humans and mice with regard to the nuclear receptors controlling the VitA-FGF15/19 axis. PMID: 26723851
  16. Ileal Fgf15 expression is a potent inhibitor of bile acid synthesis. PMID: 26040986
  17. Protective effects of farnesoid X receptor on hepatic lipid accumulation are mediated by hepatic FXR and are independent of intestinal FGF15 signaling. PMID: 25156247
  18. In mice with humanized livers human hepatocytes do not recognize FGF-15 produced by mouse intestine, resulting in up-regulation of bile acid synthesis enlargement of the bile acid pool, affecting the hepatostat. PMID: 26028580
  19. Intestinal PPARalpha-UDP- Glucuronyltransferases and downstream FXR-FGF15 signalling play vital roles in control of bile acid homeostasis and the pathological development of colitis. PMID: 25183423
  20. Sstudy shows an important contribution of ileal FGF15 to hepatocarcinogenesis in a clinically relevant mouse model where lack of Fgf15 resulted in reduced tumor burden and attenuated tumor progression. PMID: 25346390
  21. results suggest that FGF15 deficiency severely impairs liver regeneration in mice after PHx. The underlying mechanism is likely the result of disrupted bile acid homeostasis and impaired priming of hepatocyte proliferation. PMID: 24699334
  22. a direct role of intestinal FGF15/19 in the regulation of SI P450 expression and may have profound implications for the prediction of drug exposure in patients with compromised hepatic P450 function PMID: 24184963
  23. findings implicate the brain in the antidiabetic action of systemic FGF19 and establish the brain's capacity to rapidly, potently, and selectively increase insulin-independent glucose disposal PMID: 24084738
  24. Total ileal FGF15 expression was elevated almost 20-fold in Ostalpha(-/-) mice as a result of increased villus epithelial cell number and ileocyte FGF15 protein expression PMID: 22542490
  25. generated a variant of FGF19, FGF19-7, that has altered receptor specificity with a strong bias toward FGFR1c PMID: 22457778
  26. Differential specificity of endocrine FGF19 and FGF21 to FGFR1 and FGFR4 in complex with KLB. PMID: 22442730
  27. Mouse Fgf15 and human FGF19 play key roles in enterohepatic signaling, regulation of liver bile acid biosynthesis, gallbladder motility and metabolic homeostasis PMID: 22396169
  28. Pregnane X receptor activation induces FGF19-dependent tumor aggressiveness in humans and mice PMID: 21747170
  29. mice lacking FGF15 (FGF19) fail to maintain blood concentrations of glucose and normal postprandial liver glycogen; FGF19 activates a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism PMID: 21436455
  30. Fgf15 is a crucial signaling molecule regulating the postmitotic transition of dorsal neural progenitors and thus the initiation and proper progression of dorsal midbrain neurogenesis in the mouse. PMID: 21172336
  31. the physiological relevance of the contribution of the intestinal FXR-Fgf15 signalling pathway in control of hepatic bile acid synthesis PMID: 20531290
  32. the structure-function relationship of FGF19/FGF21 and the structural basis underpinning the distinct proliferative feature of FGF19 compared with FGF21 PMID: 20660733
  33. activation of FGFR4 is the mechanism whereby FGF19 can increase hepatocyte proliferation and induce hepatocellular carcinoma formation. PMID: 20018895
  34. Fgf15 is expressed in the optic vesicle, a subset of progenitor cells of neural retina, and emerging ganglion and amacrine cells during retinogenesis PMID: 15465490
  35. Fgf15 is directly regulated by Shh signaling through Gli proteins in the developing diencephalon and midbrain PMID: 15614767
  36. in the mouse, loss of FG15 gene function results in high penetrant VSDs and alignment defects of the aorta and pulmonary trunk PMID: 15789410
  37. fibroblast growth factor 15 (FGF15) signals from intestine to liver to repress the gene encoding cholesterol 7alpha-hydroxylase (CYP7A1), which catalyzes the first and rate-limiting step in the classical bile acid synthetic pathway PMID: 16213224
  38. identified two enhancers: one directed lacZ expression in the hindbrain/spinal cord and the other in the posterior midbrain (pmb), rhombomere1 (r1) and pharyngeal epithelia PMID: 16930954
  39. compare the expression pattern during neural development of chick Fgf19 with mouse Fgf15. PMID: 17654705
  40. These findings suggest that the repressor form of Gli2 preferentially binds to the GliREs to control Fgf15 expression. PMID: 18279667
  41. FGF15 and FGF8 have distinct signaling properties, and opposite effects on neocortical patterning and differentiation PMID: 18625063
  42. The results of this study indicate that both beta-Klotho and FGF-15/19 repress the apical sodium-dependent bile acid transporter in enterocytes and cholangiocytes. PMID: 18772362
  43. FGF15/FGFR4 integrates growth factor signaling with hepatic bile acid metabolism and insulin action PMID: 19237543
  44. Results suggest that FGF19-regulated liver bile acid metabolism could be independent of its glucose-lowering effect, and direct FGFR activation in adipose tissue may play an important role in the regulation of glucose homeostasis. PMID: 19706524

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Heparin-binding growth factors family
Tissue Specificity
Expressed in the developing brain.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*