Recombinant Mouse Fos-related antigen 1 (Fosl1)

Code CSB-EP008792MO
Abbreviation Recombinant Mouse Fosl1 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-273aa
Target Protein Sequence
MYRDYGEPGPSSGAGSPYGRPAQPPQAQAQTAQQQKFHLVPSIDSSSQELHWMVQPHFLGPTGYPRPLAYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGDKKDPGGSGSTSGASSPPAPGRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCSSAHRKSSSSSGDPSSDPLGSPTLLAL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.7 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
13-23 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. NF-kappaB and c-Jun coregulate lipopolysaccharide-induced Fra-1 transcription. PMID: 27286066
  2. Upon stimulation with poly(I:C), malaria parasite-infected red blood cells (iRBCs), or vesicular stomatitis virus (VSV), FOSL1 "translocated" from the nucleus to the cytoplasm, where it inhibited the interactions between TNF receptor-associated factor 3 (TRAF3), TIR domain-containing adapter inducing IFN-beta (TRIF), and Tank-binding kinase 1 (TBK1) via impairing K63-linked polyubiquitination of TRAF3 and TRIF. PMID: 28049150
  3. Adipose-derived stromal cells overexpressing Fra-1 effectively protect against osteoarthritis. PMID: 26361381
  4. Overexpression of Fosl1, which encodes a component of the AP-1 transcription factor complex, in osteoblasts significantly blocked malleal capillary narrowing. PMID: 26428006
  5. Fra-1 gene expression is activated in response lipopolysaccharide induced lung-injury in mice. PMID: 26071555
  6. Data suggest that expression of Fra1 (fos-related antigen 1) in preadipocytes is up-regulated by arachidonic acid (AA) during late stages of adipogenesis; however, in early stage of adipogenesis, AA inhibits adipogenesis via Fra1-dependent mechanism. PMID: 25325755
  7. Fra-1 plays a key role in promoting chronic CS-induced lung macrophagic inflammation in vivo PMID: 25489966
  8. we demonstrate that Fra1 negatively controls plasma cell differentiation by repressing Blimp1 expression. PMID: 25288397
  9. observations suggest that MyoD and pRb work together cooperatively at the level of the intronic enhancer of Fra-1 during terminal cell cycle arrest PMID: 25006242
  10. findings, based on a definitive genetic mouse model provide fundamental insights into mammary duct maturation and homeostasis and reveal that Scrib loss activates a MAPK/Fra1 pathway that alters mammary progenitor activity PMID: 24852022
  11. findings support the hypothesis that miR-19a-3p, which regulates tumor-associated macrophages(TAMs)in the breast tumor microenvironment,is able to regulate the phenotype of TAMs by targeting the Fra-1 gene and other genes in its downstream signaling pathway PMID: 23831570
  12. modulates the expression of detoxification genes and the adaptive response of the liver to bile acids/xenobiotic overload PMID: 23703832
  13. these results indicate that Fra-1 is a direct target of Runx2 during osteogenic differentiation of C2C12 myogenic progenitor cells. PMID: 23159633
  14. Fra-1 mediates anti-fibrotic effects in the lung through the modulation of proinflammatory, profibrotic and fibrotic gene expression. PMID: 22911824
  15. data suggest the involvement of an injury-induced Fra-1 transcription factor as a regulator of keratinocyte gene expression, which might act as an antagonistic player to restrict epithelial-driven angiogenic responses during normal skin flap integration. PMID: 21840727
  16. FRA-1, induced in response to estrogen signaling via ESR1, is a key regulator of stromal differentiation and remodeling during early pregnancy. PMID: 22514284
  17. Fra-1 (Delta/Delta) mice showed a greater resistance to LPS-induced mortality than did their Fra-1(+/+) counterparts. PMID: 21816965
  18. Fra-1 is an important mediator of interstitial lung disease following gefitinib treatment PMID: 21460858
  19. Fra-1tg mice spontaneously develop a progressive biliary disease. PMID: 21480331
  20. 4T1 cells stimulate de novo overexpression of Fra-1 in RAW264.7 cells, and then Fra-1 binds to the interleukin 6 (IL-6) promoter to increase production of cytokine IL-6 in murine RAW264.7 cells. PMID: 20386569
  21. Study supports potential roles for jun D, jun B, and fra-1 in the dietary energy restriction regulation of AP-1 function in the Sencar mouse skin carcinogenesis model. PMID: 20232358
  22. AP-1 (Fra-1/c-Jun)-mediated induction of expression of matrix metalloproteinase-2 is required for 15S-hydroxyeicosatetraenoic acid-induced angiogenesis PMID: 20353950
  23. data suggest that the Fra-1-containing transcription factor AP-1 inhibits fracture-induced endochondral ossification and bony bridge formation presumably through suppression of inflammation-induced chondrogenesis PMID: 19558315
  24. interactions between mouse breast tumor cells and tumor-associated macrophages remodel the tumor microenvironment, leading to the upregulation of Fra-1 PMID: 19966854
  25. results demonstrate that the Erk cascade plays a dual role in the co-ordinated regulation of the transcription and the phosphorylation of Fra-1 by insulin. PMID: 12197835
  26. examination of the anabolic action of Fra-1 in treatment of osteoporosis PMID: 15121008
  27. Fra-1 is an activator of bone matrix formation. PMID: 15229648
  28. reduced expression of thrombospondins in Fra1 Tg mice underlies craniofacial dysmorphism, independent of osteosclerosis. PMID: 16598380
  29. Expression of transcription factor Fra-1 was significantly elevated in emphysema lungs. PMID: 17298450
  30. FRA-1 can promote motility, invasion, and anchorage-independent growth of lung epithelial cells in vitro, but is insufficient for tumor formation PMID: 17616677
  31. Fra-1 suppresses LPS-induced mRNA expression by binding to the AP-1-binding site PMID: 19251936
  32. Inorganic phosphate regulates MGP expression in osteoblasts through the ERK1/2-Fra-1 pathway. PMID: 19419315

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
BZIP family, Fos subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*