Home
Active Protein
Other
Recombinant Mouse GDNF family receptor alpha-like (Gfral), partial (Active)

Recombinant Mouse GDNF family receptor alpha-like (Gfral), partial (Active)

^{In Stock}

Code	CSB-MP750964MO1
MSDS	MSDS
Size	$318
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Mouse Gfral at 5 μg/ml can bind Mouse Gdf15 (CSB-MP859530MO), the EC₅₀ is 7.926-10.52 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Mouse Gfral at 5 μg/mL can bind Mouse Gdf15 (CSB-MP859530MO), the EC₅₀ is 7.926-10.52 ng/mL.

Target Names

Gfral

Uniprot No.

Q6SJE0

Research Area

Cell Biology

Molecular Characterization

Species

Mus musculus (Mouse)

Source

Mammalian cell

Expression Region

20-349aa

Target Protein Sequence

QTNDCAHLIQKCLIDANGCEQSWRSMEDTCLTPGDSCKINNSLHCNLSIQALVEKNFQFKECLCMDDLHCTVNKLFGKKCTNKTDNMEKDNKDKWNLTTTPFYHGFKQMQSCLEVTEACVGDVVCNAQLALYLKACSANGNLCDVKHCQAAIRFFYQNMPFNTAQMLAFCDCAQSDIPCQQSKETLHSKPCALNIVPPPTCLSVIHTCRNDELCRTHYRTFQTECWPHITGKCHEDETCISMLGKQDLTCSGSESCRAAFLGTFGTVLQVPCACRGVTQAEEHVCMIFQHMLHSKSCFNYPTPNVKDISSYEKKNSKEITLTGFNSFFNG

Mol. Weight

42.1 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Empower your cell biology research with our Recombinant Mouse Gfral, known as GDNF family receptor alpha-like. Produced in mammalian cells, this protein is a pivotal player in the study of cellular growth, differentiation, and survival.

Our Gfral covers a partial length (20-349aa) and is expressed with a dual tag - N-terminal 10xHis-tag and C-terminal Myc-tag, assuring streamlined purification and enhanced stability. With an exceptional purity of over 95% as determined by SDS-PAGE and endotoxin levels of less than 1.0 EU/ug, our Recombinant Mouse Gfral adheres to the most stringent scientific standards. Notably, its binding ability has been confirmed in a functional ELISA, demonstrating its interaction with Mouse Gdf15. This product is supplied as a lyophilized powder for extended stability and convenience in your research workflow.

Customer Reviews and Q&A

■ Customer Reviews

Average Rating:

5.0 - 1 reviews

Submit a Review here

Applications : Drug related studies

Review: I used CSB-MP750964MO1 product for a functional ELISA experiment, EC50 was 4.701-10.78 ng/ml, and the protein had complete biological activity. The lyophilized powder I bought dissolved well according to the instructions. The protein has stable properties and high purity, and the subsequent experiments are smooth! We will continue to purchase in large quantities!

By Anonymous

Target Background

Function

Brainstem-restricted receptor for GDF15 which regulates food intake, energy expenditure and body weight in response to metabolic and toxin-induced stresses. Upon interaction with its ligand, GDF15, interacts with RET and induces cellular signaling through activation of MAPK- and AKT- signaling pathways.

Gene References into Functions

isolating GFRAL as the receptor for GDF15-induced anorexia and weight loss, the identification of a mechanistic basis for the non-homeostatic regulation of neural circuitry by a peripheral signal associated with tissue damage and stress; findings provide opportunities to develop therapeutic agents for the treatment of disorders with altered energy demand PMID: 28953886

Subcellular Location

Cell membrane; Single-pass membrane protein; Extracellular side.

Protein Families

GDNFR family

Tissue Specificity

Expressed in the brainstem, restricted to cells in the area postrema and the immediately adjacent region of the nucleus tractus solitarius.

Database Links

KEGG: mmu:404194

UniGene: Mm.213862

Promotions