Recombinant Mouse Galectin-9 (Lgals9)

Code CSB-EP012895MO
Abbreviation Recombinant Mouse Lgals9 protein
MSDS
Size $224
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
Lgals9
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-353aa
Target Protein Sequence
MALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQNSAAPVQHVFSTLQFSQPVQFPRTPKGRKQKTQNFRPAHQAPMAQTTIHMVHSTPGQMFSTPGIPPVVYPTPAYTIPFYTPIPNGLYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFNENAVVRNTQINNSWGQEERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQLTHVQT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.1 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds galactosides. Has high affinity for the Forssman pentasaccharide. Ligand for HAVCR2/TIM3. Binding to HAVCR2 induces T-helper type 1 lymphocyte (Th1) death. Also stimulates bactericidal activity in infected macrophages by causing macrophage activation and IL1B secretion which restricts intracellular bacterial growth. Ligand for P4HB; the interaction retains P4HB at the cell surface of Th2 T-helper cells, increasing disulfide reductase activity at the plasma membrane, altering the plasma membrane redox state and enhancing cell migration. Ligand for CD44; the interaction enhances binding of SMAD3 to the FOXP3 promoter, leading to up-regulation of FOXP3 expression and increased induced regulatory T (iTreg) cell stability and suppressive function. Promotes ability of mesenchymal stromal cells to suppress T-cell proliferation. Expands regulatory T-cells and induces cytotoxic T-cell apoptosis following virus infection. Activates ERK1/2 phosphorylation inducing cytokine (IL-6, IL-8, IL-12) and chemokine (CCL2) production in mast and dendritic cells. Inhibits degranulation and induces apoptosis of mast cells. Induces maturation and migration of dendritic cells. Inhibits natural killer (NK) cell function. Can transform NK cell phenotype from peripheral to decidual during pregnancy. Astrocyte derived galectin-9 enhances microglial TNF production. May play a role in thymocyte-epithelial interactions relevant to the biology of the thymus. May provide the molecular basis for urate flux across cell membranes, allowing urate that is formed during purine metabolism to efflux from cells and serving as an electrogenic transporter that plays an important role in renal and gastrointestinal urate excretion. Highly selective to the anion urate.; Acts as an eosinophil chemoattractant. It also inhibits angiogenesis. Suppresses IFNG production by natural killer cells.
Gene References into Functions
  1. galectin-9 mediates the close association of IgM and CD22. PMID: 30120235
  2. m4-1BBL and Gal-9 act together to aid aggregation of m4-1BB monomers to efficiently initiate m4-1BB signaling. PMID: 29242193
  3. this study shows that impaired Gal-9 dysregulates the blood mononuclear cells-induced Th1/Th2 imbalance in abortion-prone matings PMID: 29651447
  4. Gal9 may be a new immunomodulatory target for macrophages. PMID: 28990062
  5. these findings reveal a critical role for Tim-3-Gal-9 signaling-mediated immunoregulation by pNK cells in maternal-fetal immune tolerance and suggest that Tim-3 abundance on pNK cells is a potential biomarker for recurrent miscarriage diagnosis. PMID: 28951537
  6. in a model of experimental autoimmune encephalomyelitis, we show that an agonist of DR3 suppressed disease, correlating with expansion of CD4+Foxp3+ Tregs, and this protective effect was lost in Galectin-9-/- mice PMID: 28877989
  7. Galectin 9 is a novel dectin 1 ligand in pancreatic ductal adenocarcinoma. Upon disruption of the dectin 1-galectin 9 axis, CD4(+) and CD8(+) T cells, which are dispensable for PDA progression in hosts with an intact signaling axis, become reprogrammed into indispensable mediators of anti-tumor immunity. PMID: 28394331
  8. The Gal-9/Tim-3 signal is important for the regulation of decidua NK cells function, which is beneficial for the maintenance of a normal pregnancy. PMID: 25578313
  9. present in the spongiotrophoblast layer of the haemochorial placenta PMID: 26278059
  10. These results indicate the possibility that cooperative binding of oligosaccharide and neighboring polypeptide structures of monoclonal IgE to galectin-9 affects the overall affinity and specificity of the IgE-lectin interaction. PMID: 26582205
  11. galectin-9 functions as a novel alarmin by augmenting the inflammatory response in sepsis development during pulmonary F. novicida infection. PMID: 25898318
  12. Gal-9 has a role in the maintenance of hepatic homeostasis and preventing liver ischemia-reperfusion injury PMID: 25931247
  13. Gal-9, a natural TIM-3 ligand, was produced primarily by and released from ischemia-reperfusion-stressed hepatocytes, both in vivo and in vitro. PMID: 25450716
  14. Galectin-9 functions as an astrocyte-microglia communication signal and promotes cytokine production from microglia in a Tim-3 independent manner. PMID: 25158758
  15. galectin-9, in addition to being an effector molecule for regulatory T cells cells, acts synergistically with TGF-beta to enforce iTreg cell differentiation and maintenance. PMID: 25065622
  16. Galectin-9 is a suppressor of T and B cells and predicts the immune modulatory potential of mesenchymal stromal cell preparations. PMID: 24083426
  17. action of agonist anti-4-1BB in suppressing autoimmune and allergic inflammation was completely dependent on Galectin-9 (Gal-9). Gal-9 directly bound to 4-1BB, in a site distinct from the binding site of antibodies and the natural ligand of 4-1BB PMID: 24958847
  18. Tim-3/galectin-9 pathway plays a critical role in the homeostasis of hepatic Tregs through the elimination induction in Teffs and the inhibition of IFN-gamma release. PMID: 24333756
  19. Gal-9 expressed on corneal endothelial cells protects them from destruction by allo-reactive T cells within the cornea. PMID: 23667648
  20. contributes to the inducible immunomodulatory functions of mesenchymal stromal cells PMID: 23817958
  21. Gal-9 is induced in astrocytes by TNF via the JNK/c-Jun pathway. PMID: 23836896
  22. Galectin-9 impairs the function of NK cells, including cytotoxicity and cytokine production. PMID: 23408620
  23. These results show a differential regulation of Lgals9 isoform expression during normal and pathological pregnancies and designate Lgals9 as a potential marker for adverse pregnancy outcomes. PMID: 23242525
  24. CD4 T cells expressing Gal-9 on the cell surface (Gal-9(+) Th cells) secrete Gal-9 upon T cell receptor (TCR) stimulation. PMID: 23144904
  25. Gal-9 directly induces Tim-3+ natural killer [NK]T cell apoptosis and contributes to the depletion of NKT cells in diet-induced steatosis; Gal-9 also interacts with Tim-3-expressing Kupffer cells to induce secretion of interleukin (IL)-15. PMID: 23296703
  26. These studies are the first to show that the absence of Tim-3/gal-9 pathway interactions augments systemic graft versus host disease and regulatory T-cells contribute to it. PMID: 22677125
  27. We concluded that pro-apoptotic effects on Th1 population through galectin-9-Tim-3 pathway and the up-regulation of Tim-2 on Th2 cells might be critical to Th2-biased response of host with schistosomiasis japonica. PMID: 22469568
  28. Gal-9 negatively regulates Th2-mediated eosinophilic inflammation of the lung and Foxp3+ regulatory T cells might be involved in suppressing allergic inflammation PMID: 22627368
  29. Data show exacerbated inflammation and increased IL-17-producing Th17 cells balanced by a decrease in Foxp3+ Tregs in Gal-9(-/-) experimental allergic encephalomyelitis model. PMID: 22341088
  30. host homeostatic mechanism mediated by Gal-9/Tim-3 interaction on CD8(+) T cells can influence the outcome of HSV-1 latent infection. PMID: 22021615
  31. In a mouse food allergy model, blocking Gal-9 inhibited the allergic hypersensitivity status and the antigen-specific Th2 response in the intestine. PMID: 21426359
  32. Galectin-9 and Tim-3 are closely related to inflammatory process in asthma. PMID: 21575348
  33. The N- and C-terminal CRDs of Gal-9 contribute differently to its ability to induce T cell death and to activate dendritic cells. PMID: 21146220
  34. the T(H)1 cell surface molecule Tim3 has evolved to inhibit growth of intracellular pathogens via its ligand Gal9, which in turn inhibits expansion of effector T(H)1 cells to prevent further tissue inflammation. PMID: 20937702
  35. galectin (Gal)-9 acts to constrain CD8(+) T cell immunity to Herpes Simplex Virus (HSV) infection PMID: 20463811
  36. elevated protein level in the lungs of mice with of ovalbumin-induced allergic asthma PMID: 19851072
  37. the Tim-3-galectin-9 pathway may have evolved to ensure effective termination of effector T helper type 1 cells PMID: 16286920
  38. analysis of the crystal structure of the galectin-9 N-terminal carbohydrate recognition domain PMID: 16990264
  39. Structural analysis of LGALS9 terminal carbohydrate recognition domain reveals unexpected properties that differ from the mouse orthologue, Lgals9. PMID: 18005988
  40. galectin-9 ameliorates mouse collagen-induced arthritis by suppressing the generation of Th17, promoting the induction of regulatory T cells. PMID: 18282810
  41. Tim-3-Galectin-9 pathway plays an important role in the termination of productive Th1-immune response and could lead to developing novel therapies in transplant medicine. PMID: 18346632
  42. Gal-9 suppresses both attachment and invasion of tumor cells by inhibiting the binding of adhesive molecules on tumor cells to ligands on vascular endothelium and ECM. PMID: 18579572
  43. Gal-9 promotes natural killer cell-mediated anti-tumor activity by expanding unique macrophages with a plasmacytoid dendritic cell-like phenotype PMID: 18974023
  44. Gal-9 potentiates CD8(+) T cell-mediated antitumor immunity via Gal-9-Tim-3 interactions between DCs and CD8(+) T cells. PMID: 19017954
  45. The T cell immunoglobulin and mucin-3 (TIM-3)/galectin-9 interaction plays a critical role in influencing the expression of herpes simplex virus-induced ocular lesions. PMID: 19234217
  46. expressed on CD4(+)CD25(+) regulatory T regs involved in suppression of skin graft alloresponse PMID: 19362679
  47. gal-9 may downregulate Th1 immune response in NOD mice and could be used as a therapeutic target in autoimmune diabetes. PMID: 19670381
  48. Galectin-9 is a high affinity IgE-binding lectin with anti-allergic effect by blocking IgE-antigen complex formation PMID: 19776007
  49. Galectin 9 upregulates FcgammaRiib and down-regulates FcgammaRiii expression in macrophages and thus suppresses proinflammatory cytokine production and C5a generation. PMID: 19800850

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus. Secreted.
Tissue Specificity
Accentuated expression in liver and thymus of embryo, detected in embryonic heart, brain, lung, liver, and kidney. Highly expressed in adult thymus, small intestine, and liver, and to a lesser extent in lung, kidney, spleen, cardiac, and skeletal muscle.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*