Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Target Names

Gpx3

Uniprot No.

P46412

Research Area

Cancer

Alternative Names

Plasma glutathione peroxidase

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

25-226aa(U73S)

Target Protein Sequence

QEKSKTDCHGGMSGTIYEYGALTIDGEEYIPFKQYAGKYILFVNVASYSGLTDQYLELNALQEELGPFGLVILGFPSNQFGKQEPGENSEILPSLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTAELLGSPGRLFWEPMKIHDIRWNFEKFLVGPDGIPVMRWYHRTTVSNVKMDILSYMRRQAALSARGK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

29.8 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione.

Gene References into Functions

the antioxidant enzyme GPX3 localizes to lung extracellular matrix and is variably upregulated in interstitial lung diseases. PMID: 27435875
These results suggest that GPx3 is an important factor for inhibition of Acetaminopheninduced hepatotoxicity both in vivo and in vitro. PMID: 28677736
GPX3 promoter methylation predicts colorectal carcinoma sensitivity to platinum. PMID: 27918237
Results indicate that selenoprotein P (Sepp1) is important for this transport in selenium-replete mice but that glutathione peroxidase-3 (Gpx3) is not. PMID: 25068390
GPx3 may have a possible role in modulating prostate carcinogenesis. PMID: 21374652
Sepp1(UF) and small selenium-containing proteins are filtered by the glomerulus and taken up by PCT cells via megalin-mediated endocytosis, preventing loss of selenium in the urine and providing selenium for the synthesis of glutathione peroxidase-3 PMID: 24434121
GPX3 may play a major role in reducing hydrogen peroxide during decidualization. PMID: 24631040
an immunomodulatory role for GPX3 that limits the development of colitis-associated carcinoma. PMID: 23221387
We applied X-ray fluorescence microscopy to image selenium in mammalian tissues and identified a highly localized pool of this trace element at the basement membrane of kidneys that was associated with GPx3 PMID: 21854231
These results show that glutathione peroxidase 3 from the blood binds to basement membranes of specific epithelial cells and indicate that the cells modify their basement membranes to cause the binding. PMID: 21493731
GPx-3 deficiency results in a prothrombotic state and vascular dysfunction that promotes platelet-dependent arterial thrombosis PMID: 21518981
Inflammatory injury in the intestine elicits an increase in E-GPx in the plasma that is associated with an increase in E-GPx mRNA in the kidney. This implies that renal production of E-GPx may be sensitive to insults distal to the kidney. PMID: 11978890
The expression of Gpx3 decreased at the aortic sinus in a murine model of high-fat diet-induced atherogenesis. PMID: 16508038
GPX-3 may play a significant role in protecting cardiomyocytes from oxidative stress caused by hyperglycemia PMID: 16651743
This is the first report that a particular isotype of the glutathione peroxidase family is regulated by TCDD at both mRNA and protein levels PMID: 16682824
c-maf may be transcriptional regulator of GPx3 expression and modulate the antioxidative pathway in the kidney PMID: 16890189
GPx3 expression was reduced selectively in the adipose tissue of several obese animal models as decreasing plasma GPx3 level. PMID: 18562625

Hide All

Subcellular Location

Secreted.

Protein Families

Glutathione peroxidase family

Tissue Specificity

Secreted in plasma.

Database Links

KEGG: mmu:14778

STRING: 10090.ENSMUSP00000081011

UniGene: Mm.200916

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP009868MO(M)
Abbreviation	Recombinant Mouse Gpx3 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Glutathione peroxidase 3 (Gpx3) (U73S)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage