Recombinant Mouse Granzyme A (Gzma)

In Stock
Code CSB-EP010081MOc7
Abbreviation Recombinant Mouse Gzma protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Gzma
Uniprot No.
Research Area
Cell Biology
Alternative Names
Autocrine thymic lymphoma granzyme-like serine protease;CTLA-3;Fragmentin-1;T cell-specific serine protease 1;TSP-1
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
29-260aa
Target Protein Sequence
IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent pyroptosis when delivered into the target cell through the immunological synapse. It cleaves after Lys or Arg. Cleaves APEX1 after 'Lys-31' and destroys its oxidative repair activity. Cleaves the nucleosome assembly protein SET after 'Lys-189', which disrupts its nucleosome assembly activity and allows the SET complex to translocate into the nucleus to nick and degrade the DNA.
Gene References into Functions
  1. GzmA and gzmB were predominantly expressed by natural killer cells, and during abdominal sepsis, the percentage of these cells expressing gzms in peritoneal lavage fluid decreased, while the amount of expression in the gzm(+) cells increased PMID: 28694562
  2. a novel endogenous trigger for autoimmune diabetes and an in vivo role for granzyme A in maintaining immune tolerance. PMID: 28733313
  3. this study shows that gzmA and gzmB partly regulate local inflammation during early pneumonia but eventually play an insignificant role during pneumosepsis by the common human pathogen Klebsiella pneumoniae PMID: 26894590
  4. Granzyme A does not have a crucial role in vivo in the protective response to tuberculosis. PMID: 27055232
  5. Data indicate N-terminomics on the human and mouse granzymes A and K by combined fractional diagonal chromatography (COFRADIC). PMID: 25383893
  6. The results, in susceptible B6 mice for GzmB and in resistant 129/Sv mice for GzmA and/or the GzmB cluster, point to granzyme-mediated host defense regulation in the liver in experimental visceral leishmaniasis. PMID: 25452549
  7. Estrogen increases the extracellular expression and interleukin (IL)-12-induced activity of a critical member of serine protease family granzyme A. PMID: 24840346
  8. functional divergence between human and mouse granzyme A PMID: 24505135
  9. We have demonstrated that cell death can be induced when mGzmA is delivered by primary natural killer cells via authentic Cytotoxic lymphocyte/target cell interactions. PMID: 23744295
  10. Regulated secretion of granzyme A and cytotoxic killing was enhanced and correlated with increased vesicle-associated membrane protein 7 availability. PMID: 23084031
  11. GzmA deficiency in filarial infection is linked with reduced inflammation and a trend toward increased alternatively activated macrophages. PMID: 21248253
  12. granzyme A- and B-cluster deficiency delays the acute progression of pneumovirus disease by reducing alveolar injury. PMID: 20018616
  13. the genes for perforin, the three major T cell granzymes (A-C) and IFN-gamma are differentially expressed during primary activation of naive CD8(+) T cells, kinetically and at the single-cell level PMID: 12039912
  14. granzyme A and granzyme B have a similar potential to induce rapid perf-mediated apoptosis but that their individual contribution to the underlying intracellular process is dictated by the quality of the target cell PMID: 12115618
  15. NK cell mediated tumor control is dependent on granzymes. PMID: 12355441
  16. some cytolytic T lymphocytes mature into perforin/granzyme-expressing effector cells in the mediastinal lymph node and are detectable when they accumulate in lung infection PMID: 12601154
  17. In all tumor models examined thus far, granzyme A is not necessary for tumor rejection mediated by the perforin pathway in vivo. PMID: 12847210
  18. gzmA and gzmB induce multiple independent cell death pathways; all gzm-induced apoptotic features analyzed depend critically on perf. PMID: 15534000
  19. polymorphonuclear leukocytes from mice and humans lack the 3 cytotoxic effector molecules, gzmA, granzyme B, and perforin, generally associated with natural killer and cytotoxic T lymphocytes PMID: 15998831
  20. IL-2 increased the expression of perforin and granzyme A, B, and C mRNA; induction of granzyme A, B, and C mRNA required exogenous IL-2, whereas induction of perforin and IFN-gamma expression did not. PMID: 16339537
  21. CTLs from granzyme AB(-/-) mice induce target cell death by a unique mechanism that is distinct from both perforin lysis and apoptosis. PMID: 16606695
  22. Mouse granzyme B is 30 times less cytotoxic than human granzyme B and does not require Bid for killing but regains cytotoxicity on engineering of its active site cleft. Mouse granzyme A is considerably more cytotoxic than human granzyme A. PMID: 17116752
  23. Skin-, but not lung-associated primary mast cells as well as in vitro-differentiated bone marrow-derived mast cells (BMMC) express granzyme (gzm) B, but not gzmA or perforin (perf). PMID: 17599099
  24. GzmA accesses the mitochondrial matrix to cleave the complex I protein NDUFS3, an iron-sulfur subunit of the NADH:ubiquinone oxidoreductase complex I. PMID: 18485875
  25. grzK plays an important role in CD8(+) T-cell cytotoxicity both in the presence and absence of grzA and B. PMID: 18788942
  26. the granule secretory pathway plays an unexpected role in inflammation, with GzmA acting as an endogenous modulator. PMID: 18951048
  27. Neither gzmA nor gzmB is required for rapid and efficient in vivo cytotoxicity by cytotoxic T (Tc) cells. PMID: 19525394

Show More

Hide All

Subcellular Location
Secreted. Cytoplasmic granule.
Protein Families
Peptidase S1 family, Granzyme subfamily
Tissue Specificity
Found in cytotoxic lymphocytes and in normal lymphoid tissues such as thymus and spleen.; [Isoform HF1]: More abundant in lymphoid tissues than isoform HF2.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*