Home
Active Protein
Other
Recombinant Mouse Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (Itpripl1), partial (Active)

Recombinant Mouse Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (Itpripl1), partial (Active)

^{In Stock}

Code	CSB-MP011916MO1
Abbreviation	Recombinant Mouse Itpripl1 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$136
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Mouse Itpripl1 at 2 μg/ml can bind Anti-ITPRIPL1 recombinant antibody (CSB-RA756966MA1HU). The EC₅₀ is 0.7534-0.9877 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Mouse Itpripl1 at 2 μg/mL can bind Anti-ITPRIPL1 recombinant antibody (CSB-RA756966MA1HU). The EC50 is 0.7534-0.9877 ng/mL.

Target Names

Itpripl1

Uniprot No.

A2ASA8

Alternative Names

Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1; Itpripl1

Species

Mus musculus (Mouse)

Source

Mammalian cell

Expression Region

23-96aa

Target Protein Sequence

DRMDLDTLARSRQLEKRMSEEMRQLEMEFEERSRAAEQKQKVENFWRGDTSSDQLVLGKKDMGWPFQAGGQDGG

Mol. Weight

10.0 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Itpripl1 modulates calcium signaling through its interaction with inositol 1,4,5-trisphosphate receptors, making it a valuable tool for dissecting intracellular calcium dynamics and IP3R-dependent pathways. This partial construct spanning residues 23–96 demonstrates robust antibody-binding activity in functional ELISA, with an EC50 of 0.75–0.99 ng/mL when immobilized at 2 μg/mL and challenged with anti-ITPRIPL1 recombinant antibody, confirming proper folding and epitope accessibility. The quantitative binding data supports its use in antibody validation assays, epitope mapping studies, and as a positive control in immunoassays targeting Itpripl1. Mammalian cell expression yields a protein that exceeds 95% purity by SDS-PAGE with endotoxin levels below 1.0 EU/μg, meeting the quality thresholds commonly required for cell-based binding experiments and functional assays where low endotoxin is critical.