Recombinant Mouse Integrin alpha-L(Itgal) ,partial

Product Type Recombinant Protein
Uniprot No. P24063
Species Mus musculus (Mouse)
Research Area Others
Gene Names Itgal
Protein Names Recommended name: Integrin alpha-L Alternative name(s): CD11 antigen-like family member A Leukocyte adhesion glycoprotein LFA-1 alpha chain Short name= LFA-1A Leukocyte function-associated molecule 1 alpha chain Lymphocyte antig
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Target Details ITGAL encodes the integrin alpha L chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form the integrin lymphocyte function-associated antigen-1 (LFA-1), which is expressed on all leukocytes. LFA-1 plays a central role in leukocyte intercellular adhesion through interactions with its ligands, ICAMs 1-3 (intercellular adhesion molecules 1 through 3), and also functions in lymphocyte costimulatory signaling. Two transcript variants encoding different isoforms have been found for this gene.
Function Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families Integrin alpha chain family
Tissue Specificity Leukocytes.
Database Links

STRING: 10090.ENSMUSP00000101913

UniGene: Mm.1618

Pathway Regulation of actin cytoskeleton
Leukocyte transendothelial migration
Natural killer cell mediated cytotoxicity
Rap1 signaling pathway

Product Details for Different Expression Systems

Product Name Recombinant Mouse Integrin alpha-L(Itgal) ,partial,Baculovirus
Code CSB-BP011875MO
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence DLVFLFDGSQSLDRKDFEKILEFMKDVMRKLSNTSYQFAAVQFSTDCRTEFTFLDYVKQNKNPDVLLGSVQPMFLLTNTFRAINYVVAHVFKEESGARPDATKVLVIITDGEASDKGNISAAHDITRYIIGIGKHFVSVQKQKTLHIFASEPVEEFVKILDTFEKLKDLFTDL
Expression Region 153-325aa
Protein Description Partial
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Mouse Integrin alpha-L(Itgal) ,partial,Mammalian cell
Code CSB-MP011875MO
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence DLVFLFDGSQSLDRKDFEKILEFMKDVMRKLSNTSYQFAAVQFSTDCRTEFTFLDYVKQNKNPDVLLGSVQPMFLLTNTFRAINYVVAHVFKEESGARPDATKVLVIITDGEASDKGNISAAHDITRYIIGIGKHFVSVQKQKTLHIFASEPVEEFVKILDTFEKLKDLFTDL
Expression Region 153-325aa
Protein Description Partial
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

Itgal Antibodies

Itgal Antibodies for Mus musculus (Mouse)

Itgal Proteins

Itgal Proteins for Mus musculus (Mouse)

Itgal ELISA Kit

Itgal ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.