Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Product Type | Recombinant Protein |
| Uniprot No. | P24063 |
| Species | Mus musculus (Mouse) |
| Research Area | Others |
| Gene Names | Itgal |
| Protein Names | Recommended name: Integrin alpha-L Alternative name(s): CD11 antigen-like family member A Leukocyte adhesion glycoprotein LFA-1 alpha chain Short name= LFA-1A Leukocyte function-associated molecule 1 alpha chain Lymphocyte antig |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. |
| Target Details | ITGAL encodes the integrin alpha L chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form the integrin lymphocyte function-associated antigen-1 (LFA-1), which is expressed on all leukocytes. LFA-1 plays a central role in leukocyte intercellular adhesion through interactions with its ligands, ICAMs 1-3 (intercellular adhesion molecules 1 through 3), and also functions in lymphocyte costimulatory signaling. Two transcript variants encoding different isoforms have been found for this gene. |
| Function | Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4 |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein |
| Protein Families | Integrin alpha chain family |
| Tissue Specificity | Leukocytes. |
| Database Links |
STRING: 10090.ENSMUSP00000101913 UniGene: Mm.1618 |
| Pathway |
Regulation of actin cytoskeleton
Leukocyte transendothelial migration Natural killer cell mediated cytotoxicity Rap1 signaling pathway |
| Product Name | Recombinant Mouse Integrin alpha-L(Itgal) ,partial,Baculovirus |
| Code | CSB-BP011875MO |
| Size | Pls inquiry other sizes |
| Source | Baculovirus |
| Purity | >85% (SDS-PAGE) |
| Tag Info | The following tags are available. N-terminal His-tagged and C-terminal Myc-tagged N-terminal His-tagged Tag-Free The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
|
| Sequence | DLVFLFDGSQSLDRKDFEKILEFMKDVMRKLSNTSYQFAAVQFSTDCRTEFTFLDYVKQNKNPDVLLGSVQPMFLLTNTFRAINYVVAHVFKEESGARPDATKVLVIITDGEASDKGNISAAHDITRYIIGIGKHFVSVQKQKTLHIFASEPVEEFVKILDTFEKLKDLFTDL |
| Expression Region | 153-325aa |
| Protein Description | Partial |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Product Name | Recombinant Mouse Integrin alpha-L(Itgal) ,partial,Mammalian cell |
| Code | CSB-MP011875MO |
| Size | Pls inquiry other sizes |
| Source | Mammalian cell |
| Purity | >85% (SDS-PAGE) |
| Tag Info | The following tags are available. N-terminal His-tagged and C-terminal Myc-tagged N-terminal His-tagged Tag-Free The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
|
| Sequence | DLVFLFDGSQSLDRKDFEKILEFMKDVMRKLSNTSYQFAAVQFSTDCRTEFTFLDYVKQNKNPDVLLGSVQPMFLLTNTFRAINYVVAHVFKEESGARPDATKVLVIITDGEASDKGNISAAHDITRYIIGIGKHFVSVQKQKTLHIFASEPVEEFVKILDTFEKLKDLFTDL |
| Expression Region | 153-325aa |
| Protein Description | Partial |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
Itgal Antibodies for Mus musculus (Mouse)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA011875LD01MO | Itgal Antibody, Biotin conjugated | Mouse | ELISA |
| CSB-PA011875LB01MO | Itgal Antibody, HRP conjugated | Mouse | ELISA |
| CSB-PA011875LC01MO | Itgal Antibody, FITC conjugated | Mouse | ELISA |
| CSB-PA011875LA01MO | Itgal Antibody | Mouse | ELISA |
Itgal Proteins for Mus musculus (Mouse)
| Code | Product Name | Source |
|---|---|---|
| CSB-EP011875MO | Recombinant Mouse Integrin alpha-L(Itgal),partial | E.coli |
| CSB-YP011875MO | Recombinant Mouse Integrin alpha-L(Itgal),partial | Yeast |
Itgal ELISA Kit for Mus musculus (Mouse)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-EL011875MO | Mouse Integrin alpha-L(ITGAL) ELISA kit | serum, plasma, tissue homogenates, cell lysates | 5.86 pg/mL |
Recombinant Chicken Collagen alpha-1(XII) chain(COL12A1) ,partial
Express system: E.coli
Species: Gallus gallus (Chicken)
Recombinant Bovine Muellerian-inhibiting factor(AMH),Yeast
Express system: Yeast
Species: Bos taurus (Bovine)
Recombinant Human Butyrophilin subfamily 3 member A1(BTN3A1),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Dog Matrix metalloproteinase-9(MMP9)
Express system: Yeast
Species: Canis lupus familiaris (Dog) (Canis familiaris)
Recombinant Human Suppressor of cytokine signaling 2(SOCS2)
Express system: E.coli
Species: Homo sapiens (Human)
