Recombinant Mouse Integrin alpha-L(Itgal) ,partial

Code	CSB-BP011875MO
Size	Pls inquire other sizes
Source	Baculovirus

Code	CSB-EP011875MO-B
Size	Pls inquire other sizes
Source	E.coli
Conjugate	Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.

Code	CSB-MP011875MO
Size	Pls inquire other sizes
Source	Mammalian cell

Product Details
Related Products
Target Data

Product Details

Purity	>85% (SDS-PAGE)
Target Names	Itgal
Uniprot No.	P24063
Research Area	Others
Species	Mus musculus (Mouse)
Expression Region	153-325aa
Target Protein Sequence	DLVFLFDGSQSLDRKDFEKILEFMKDVMRKLSNTSYQFAAVQFSTDCRTEFTFLDYVKQNKNPDVLLGSVQPMFLLTNTFRAINYVVAHVFKEESGARPDATKVLVIITDGEASDKGNISAAHDITRYIIGIGKHFVSVQKQKTLHIFASEPVEEFVKILDTFEKLKDLFTDL
Mol. Weight	21.7kD
Protein Length	Full Length of Mature Protein
Tag Info	The following tags are available. N-terminal His-tagged and C-terminal Myc-tagged N-terminal His-tagged Tag-Free The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form	Lyophilized powder
Buffer before Lyophilization	Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Datasheet	Please contact us to get it.
Still Have Questions?	Start a Chat

Target Data

Function	Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4
Subcellular Location	Cell membrane, Single-pass type I membrane protein
Protein Families	Integrin alpha chain family
Tissue Specificity	Leukocytes.
Database Links	STRING: 10090.ENSMUSP00000101913 UniGene: Mm.1618