Recombinant Mouse Integrin alpha-L(Itgal),partial

Code CSB-EP011875MO
Product Type Recombinant Protein
Size US$2466
Uniprot No. P24063
Relevance Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Is involved in a variety of immune phenomena including leukocyte-endothelial cell interaction, cytotoxic T-cell mediated killing, and antibody dependent killing by granulocytes and monocytes. Mice expressing a null mutation of the alpha-L subunit gene donstrate impaired tumor rejection and impaired leukocytes recruitment.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias CD11 antigen-like family member ALeukocyte adhesion glycoprotein LFA-1 alpha chain ;LFA-1ALeukocyte function-associated molecule 1 alpha chain;Lymphocyte antigen 15 ;Ly-15; CD11a
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence DLVFLFDGSQSLDRKDFEKILEFMKDVMRKLSNTSYQFAAVQFSTDCRTEFTFLDYVKQNKNPDVLLGSVQPMFLLTNTFRAINYVVAHVFKEESGARPDATKVLVIITDGEASDKGNISAAHDITRYIIGIGKHFVSVQKQKTLHIFASEPVEEFVKILDTFEKLKDLFTDL
Research Area Others
Source E.coli
Gene Names Itgal
Expression Region 153-325aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 23.7kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families Integrin alpha chain family
Tissue Specificity Leukocytes.
Database Links

STRING: 10090.ENSMUSP00000101913

UniGene: Mm.1618

Pathway Regulation of actin cytoskeleton
Leukocyte transendothelial migration
Natural killer cell mediated cytotoxicity
Rap1 signaling pathway

Related Products

Itgal Antibodies

Itgal Antibodies for Mus musculus (Mouse)

Itgal Proteins

Itgal Proteins for Mus musculus (Mouse)

Itgal ELISA Kit

Itgal ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.