Recombinant Mouse Interferon epsilon(Ifne)

Code CSB-YP800374MO
Product Type Recombinant Protein
Size US$2474
Uniprot No. Q80ZF2
Abbreviation Ifne
Relevance Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the fale reproductive tract. Directly mediates protection against viral, including HSV-2, and bacterial, including Chlamydia muridarum, genital infections.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Interferon epsilon-1Interferon tau-1
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LEPKRIPFQLWMNRESLQLLKPLPSSSVQQCLAHRKNFLLPQQPVSPHQYQEGQVLAVVHEILQQIFTLLQTHGTMGIWEENHIEKVLAALHRQLEYVESLGGLNAAQKSGGSSAQNLRLQIKAYFRRIHDYLENQRYSSCAWIIVQTEIHRCMFFVFRFTTWLSRQDPDP
Research Area Others
Source Yeast
Gene Names Ifne
Protein Names Recommended name: Interferon epsilon Short name= IFN-epsilon Alternative name(s): Interferon epsilon-1 Interferon tau-1
Expression Region 22-192aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 22.0kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the female reproductive tract. Directly mediates protection against viral, including HSV-2, and bacterial, including Chlamydia muridarum, genital infections.
Subcellular Location Secreted
Protein Families Alpha/beta interferon family
Tissue Specificity Expressed at very high levels in uterus and, at much lower levels, in ovary and cervix. Very low levels, if any, in other organs. In the endometrium, expressed in the luminal and glandular epithelial cells (at protein level).
Database Links

KEGG: mmu:230405

STRING: 10090.ENSMUSP00000059199

UniGene: Mm.246593

Pathway Jak-STAT signaling pathway

Related Products

Ifne Antibodies

Ifne Antibodies for Mus musculus (Mouse)

Ifne Proteins

Ifne Proteins for Mus musculus (Mouse)

Ifne ELISA Kit

Ifne ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.