Recombinant Mouse Interleukin-1 receptor type 1 (Il1r1), partial

In Stock
Code CSB-MP011621MO1
Abbreviation Recombinant Mouse Il1r1 protein, partial
MSDS
Size $118
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Immunology
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
20-338aa
Target Protein Sequence
LEIDVCTEYPNQIVLFLSVNEIDIRKCPLTPNKMHGDTIIWYKNDSKTPISADRDSRIHQQNEHLWFVPAKVEDSGYYYCIVRNSTYCLKTKVTVTVLENDPGLCYSTQATFPQRLHIAGDGSLVCPYVSYFKDENNELPEVQWYKNCKPLLLDNVSFFGVKDKLLVRNVAEEHRGDYICRMSYTFRGKQYPVTRVIQFITIDENKRDRPVILSPRNETIEADPGSMIQLICNVTGQFSDLVYWKWNGSEIEWNDPFLAEDYQFVEHPSTKRKYTLITTLNISEVKSQFYRYPFICVVKNTNIFESAHVQLIYPVPDFK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
38.7 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for IL1A, IL1B and IL1RN. After binding to interleukin-1 associates with the coreceptor IL1RAP to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-dependent activation of NF-kappa-B, MAPK and other pathways. Signaling involves the recruitment of adapter molecules such as TOLLIP, MYD88, and IRAK1 or IRAK2 via the respective TIR domains of the receptor/coreceptor subunits. Binds ligands with comparable affinity and binding of antagonist IL1RN prevents association with IL1RAP to form a signaling complex. Involved in IL1B-mediated costimulation of IFNG production from T-helper 1 (Th1) cells.; Unable to mediate canonical IL-1 signaling. Cooperates with IL1RAP isoform 3 to mediate IL1B-induced neuronal activity including IL1B-potentiated NMDA-induced calcium influx mediated by Akt kinase activation.
Gene References into Functions
  1. Study conclude that while interleukin-1 signaling is not critical for lipopolysaccharide induced anorexia or stress hormone release, interleukin-1 type 1 receptor expressed on brain endothelial cells, contributes to the febrile response to lipopolysaccharide. PMID: 28655587
  2. Data indicate that IL-1RI and TNF-1R contribute to regulation of stress-induced, negatively reinforced drinking perhaps through overlapping signaling events downstream of these receptors, while leaving rewarding properties of alcohol largely unaffected. PMID: 27273552
  3. interleukin-1 receptor 1/MyD88 signalling has roles in the development and progression of pulmonary hypertension PMID: 27418552
  4. These results suggest that cytokines, particularly IL-1, areassociated with pulmonary anti-influenza immune response and inflammatory lung injury, particularly via the influence on neutrophil mobilization and inflammatory cytokine/chemokine production. PMID: 28585438
  5. Using respective knockout mice it was found that LPS-mediated GIP secretion was selectively dependent on IL-1 signalling. PMID: 27350651
  6. Results demonstrated the essential role of IL-1R1 in kindling-induced sleep disturbance by using transgenic IL-1R1 KO mice. Epilepsy-induced sleep disturbances were absent in the IL-1R1 KO mice, indicating the importance of IL-1 signals. The knockout of IL-1R1 did not change the seizure thresholds, suggesting that IL-1R1 signaling is not in involved in the kindling-induced epileptogenesis. PMID: 27875989
  7. findings show elements of the IL-1 network, including IL-1alpha, IL-1beta, and IL-1R1, are essential for the optimal host response to VACV cutaneous infection PMID: 28468973
  8. These data show that the normal distribution of surface glycosylation requires IL-1R, but not MyD88, and is not sufficient to prevent bacterial binding. PMID: 28223334
  9. Study provides direct evidence that IL-1R1 is a potent target for adjunctive control of diazepam refractory status epilepticus in mice. Both pharmacological block and gene KO of IL-1R1 may reverse or prevent the progressive diazepam-refractoriness of status epilepticus in mice. Thus, combination of IL-1R1 antagonists with diazepam may be a novel strategy for the treatment of refractory prolonged status epilepticus. PMID: 27133574
  10. IL-1R1 signaling via MyD88 is critical for the first step of inflammatory response to papain. PMID: 27569535
  11. IL-1 receptor (IL-1R1) deficiency or blockade limits blood pressure elevation in this model by mitigating sodium reabsorption via the NKCC2 co-transporter in the nephron. PMID: 26712462
  12. mediates signals by allograft parenchymal cells in generating the stimuli-provoking development and elicitation of optimal alloimmune responses to the grafts PMID: 26856697
  13. data identify a previously unappreciated Trim24-dependent requirement for IL-1R expression on TH2 cells and an important nonredundant role for T-cell-intrinsic Trim24 in TH2-mediated allergy and antihelminth immunity PMID: 26787865
  14. The results present identification of critical regions within the TIR domain of IL-1 receptor type in humans and mice. PMID: 26279140
  15. IL-1R1/MyD88 signaling negatively regulates bone regeneration via impairment of mesenchymal stem cell proliferation, migration and differentiation by inhibiting the Akt/GSK-3beta/beta-catenin pathway. PMID: 27001940
  16. adult mice lacking interleukin-1 receptor 1 (IL-1R1) exhibit increased expression of both the excitatory scaffolding protein postsynaptic density-95 (PSD-95) and inhibitory scaffolding proteingephyrin, respectively, in the hippocampus. PMID: 25263489
  17. these studies demonstrate, through the use of novel transgenic mice, that IL1R1 on neurons and astrocytes differentially mediates aspects of sleep PMID: 25849975
  18. Results suggest that the IL-1R1/IL-1ra complex regulates specific ethanol behaviors and affects the sensitivity to flurazepam sedation PMID: 25839897
  19. IL-1R1 contributes to the IMQ-induced skin inflammation, and disruption of MyD88 signaling completely abrogates this response. PMID: 26147228
  20. Data show that interleukin 1beta (IL-1beta) increased the expression of the IL-1 receptor type 1 in hippocampal neuronal cultures. PMID: 26305968
  21. Because IL-1R-/- mice have impaired bystander responses during in vivo infection, we investigated whether IL-1R signaling was sufficient to induce TNF, IL-6, or CD86 expression in various innate immune cell types. PMID: 26034289
  22. These results demonstrate this IL-1R1 restore model is a valuable tool for studying cell-type-specific functions of IL-1R1. PMID: 25698726
  23. the NLRP3 inflammasome/IL-1RI axis is dispensable for PM10-facilitated allergic sensitization. PMID: 24988285
  24. Contrary to prior studies, IL-1RI(-/-) mice are not robustly impaired on hippocampal-dependent memory. PMID: 24205219
  25. major population of intestinal lamina propria lymphocytes expressing IL-1 receptor 1 (IL-1R1) is the lymphoid tissue inducer (LTi)-like cell PMID: 23750260
  26. Overexpression of Sprouty4 or pharmacological inhibition of ERK upregulated IL-1R1 expression in primary T cells. PMID: 24732356
  27. The role of IL-1 receptor and toll-like receptor 2 in the induction of MyD88-dependent immunization with a Coccidioides vaccine are reported. PMID: 24614655
  28. These results demonstrate a role for the NLRP3 inflammasome in the control of Trypanosoma cruzi infection and identify NLRP3-mediated, caspase-1-dependent and IL-1R-independent nitric oxide production as a novel effector mechanism. PMID: 24098823
  29. Both wild-type (WT) and eIL-1R1kd mice had increased circulating monocytes PMID: 24523548
  30. IL-1 signaling, via IL-1R1 and MyD88, is required for development of postoperative ileus after intestinal manipulation in mice. PMID: 24067878
  31. early stimulation of fibroblast IL-1R1 signaling during the inflammatory phase may prevent premature activation of a matrix-synthetic contractile phenotype until the wound is cleared, and the infarct microenvironment can support mesenchymal cell growth. PMID: 24078695
  32. Knockout of IL-1RI protected mice from high fat diet-induced adipose tissue inflammation and insulin resistance. PMID: 22841542
  33. These findings indicate an important interaction between dietary fat and IL-1R, relevant to optimal metabolic health. PMID: 23921145
  34. These results suggest that IL-1RI is involved in normal growth plate development and extracellular matrix homeostasis and that it is significant in the physiological process of bone modeling. PMID: 23592480
  35. These results demonstrate that IL-1alpha and IL-1R1 signaling is essential for microabscess formation, neutrophil recruiting chemokine expression, and acanthosis in psoriasis-like skin inflammation induced by imiquimod. PMID: 23407395
  36. High viral persistence is found in the late stage of Theiler's virus infection in IL-1R-deficient mice. PMID: 22985464
  37. Functional IL-1 receptor is required for Th17, but not Th2, cytokine production after in vitro antigen restimulation of lung cells. PMID: 23371061
  38. data indicate that IL-1R1 signaling promotes virologic control during West Nile virus infection specifically within the central nervous system PMID: 23460727
  39. study found that after infection with live influenza A virus, signaling through the interleukin 1 receptor was required for productive priming of CD8( ) T cells, but signaling through the pattern-recognition receptors TLR7 and RIG-I was not PMID: 23314004
  40. IL-1RI signalling is a major antimicrobial effector pathway during acute brain-abscess formation. PMID: 22414156
  41. Doxorubicin toxicity increased IL-1RI expression in cardiac tissues. Expression correlated with histology score in cardiotoxic injury. PMID: 22000485
  42. Lymphocytic choriomeningitis virus is not cleared in IL-1R-deficient mice, and yet the infected mice develop neither splenomegaly nor hepatitis. PMID: 22674984
  43. IL1R activation contributes to hypersomnolence that occurs after sleep loss PMID: 22387068
  44. The immune pathogenesis of IL-1/IL-1R1 signaling on the ocular surface and in the lacrimal gland depends on tissue-specific CD4+ T cells and activation of IL-1R1-expressing epithelial and stromal cells. PMID: 22231738
  45. These results indicate that IL-1R signaling is required at multiple steps during the course of sensitization and challenge to elicit Contact hypersensitivity. PMID: 22238457
  46. TIR8 has a nonredundant effect in modulating the inflammation caused by Pseudomonas aeruginosa, in particular, by negatively regulating IL-1RI signaling, which plays a major role in the pathogenesis of bacterial pneumonia. PMID: 22025515
  47. Inhibition of MyD88- or IL-1 receptor signalling reduces neointima formation in response to carotid artery injury. PMID: 21421554
  48. The response in aged IL-1R knockout mice differs from wild-type mice in that starvation increases atrophy and is associated with decreased cell proliferation rather than increased apoptosis. PMID: 20605606
  49. Lack of IL-1RI protects against HFD-induced IR coincident with reduced local adipose tissue inflammation, despite equivalent immune cell recruitment. PMID: 21515850
  50. Following exposure to cigarette smoke in IL-1RI-deficient mice, PTX3 expression is not enhanced compared to wild-type mice. PMID: 20920344

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein. Cell membrane. Secreted.
Protein Families
Interleukin-1 receptor family
Tissue Specificity
Isoform 2 is expressed in various brain tissues.
Database Links

KEGG: mmu:16177

STRING: 10090.ENSMUSP00000027241

UniGene: Mm.896

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*