Recombinant Mouse Interleukin-2 receptor subunit alpha (Il2ra), partial (Active)

In Stock
Code CSB-MP011649MO1
Abbreviation Recombinant Mouse Il2ra protein, partial (Active)
MSDS
Size $118
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Mouse Il2ra at 2 μg/ml can bind Mouse Il2 (CSB-MP011629MOd9). The EC50 is 95.00-116.2 ng/mL. Biological Activity Assay
  • The purity of Il2ra was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse Il2ra at 2 μg/mL can bind Mouse Il2 (CSB-MP011629MOd9). The EC50 is 95.00-116.2 ng/mL.
Target Names
Uniprot No.
Alternative Names
Interleukin-2 receptor subunit alpha; IL-2 receptor subunit alpha; IL-2-RA; IL-2R subunit alpha; IL2-RA;p55; CD25; Il2ra; Il2r
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
22-236aa
Target Protein Sequence
ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYK
Mol. Weight
26.5 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

CD25, the high-affinity alpha subunit of the IL-2 receptor, plays a central role in T cell activation and is a validated target in cancer immunotherapy and autoimmune disease research. This mammalian-expressed construct spanning residues 22–236 captures the complete extracellular ligand-binding domain and demonstrates quantified binding to mouse IL-2 with an EC50 of 95.00–116.2 ng/mL in functional ELISA, providing a defined benchmark for ligand-receptor interaction studies and competitive inhibition assays. The mammalian expression system ensures native glycosylation and disulfide bond formation critical for conformational integrity in surface plasmon resonance, biolayer interferometry, and therapeutic antibody epitope mapping experiments. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for blocking antibody screening, small-molecule inhibitor discovery, and affinity characterization workflows targeting the IL-2/IL-2R axis in immuno-oncology research.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for interleukin-2. The receptor is involved in the regulation of immune tolerance by controlling regulatory T cells (TREGs) activity. TREGs suppress the activation and expansion of autoreactive T-cells.
Gene References into Functions
  1. Analyze the percentage of CD4(+)CD25(-)T cells. PMID: 28810531
  2. Results indicate that conjugated-interleukin-2 (IL2) protein derived from NKTR-214 occupy interleukin-2 (IL2) receptor complex (IL2Ralphabetagamma) to a greater extent compared to free-IL2 protein. PMID: 28678791
  3. CDK6-mediated suppression of CD25 is required for initiation of T-ALL by activated Notch1. . Pharmacologic inhibition of CDK6 kinase induces CD25 and RUNX1 expression, cell cycle arrest and apoptosis in mouse and human T-ALL. PMID: 26707936
  4. murine podocytes express the IL-2R, and activation through the IL-2R results in podocyte injury PMID: 27389192
  5. Combination with anti-programmed cell death protein-1 (PD-1) antibodies promoted complete tumor rejection, indicating the relevance of CD25 antigen as a therapeutic target and promising substrate for future combination approaches in immune-oncology. PMID: 28410988
  6. Intratesticular inoculation with donor antigens promotes long-term skin allograft survival induced by conventional costimulatory blockade via the induction of both CD8 + CD122+ and CD4 + CD25+ Treg cells. PMID: 26569069
  7. Expansion of CD25-expressing innate lymhpoid cells by IL-2/anti-IL-2 complexes leads to a reduction in very low-density lipoprotein cholesterol and atherosclerosis. PMID: 26494229
  8. our results identify IL-7 as a necessary factor contributing to sustained CD25 expression at Treg surface in vivo thereby affecting their ability to efficiently react to IL-2. PMID: 25485946
  9. Data indicate that the deletion of interferon-gamma (IFN-gamma) in the CD25 knockout (KO) mice delays glandular destruction and preserves glandular function. PMID: 23116218
  10. Functional NK cell repertoires are maintained through IL-2Ralpha and Fas ligand. PMID: 24634493
  11. Ag-dependent signals activated low IL-2Ralpha & high IL-2 production, independent of IL-2 signaling. Later, secreted IL-2 acted as a shared resource driving high IL-2Ralpha expression. PMID: 24244020
  12. Therefore, EXOs derived from natural CD4(+)25(+) and CD8(+)25(+) Tr cells may become an alternative for immunotherapy of autoimmune diseases. PMID: 23876314
  13. Infections with murine cytomegalovirus, but not with lymphocytic choriomeningitis virus, induce CD25 on natural killer (NK) cells, along with high levels of interleukin (IL)-12. PMID: 22888135
  14. Hepatic stellate cells seem to act as liver-resident antigen-presenting cells instructing the generation of CD4/CD25/Foxp3(+) regulatory T cells. PMID: 22564624
  15. Ablation of the CD25+ dendritic cell subset accounts for decreased activation and expansion of gammadelta T cells, leading to decreased activation of IL-17-positive interphotoreceptor retinoid-binding protein-specific T cells. PMID: 22539790
  16. leflunomide has an effect on CD4(+)CD25 (+)Foxp3 (+) T regulatory cells in mice receiving allogeneic bone marrow transplantation PMID: 22057872
  17. Dexamethasone could promote the expression of CD25 and FOXP3 in the mouse asthma model. PMID: 21265093
  18. HMGB1 has the ability to directly modulate the suppressive capacity of CD4(+)CD25(+)Tregs, and TLR4 might be a potential receptor essential for the negative effect of HMGB1 on CD4(+)CD25(+)Tregs activity PMID: 21419643
  19. All mice given presensitized CD25-depleted T cells survived a tumor rechallenge, indicating the development of long-term CD8 T-cell memory to tumor antigens. PMID: 21521781
  20. Data show that CD8(+) T cell tolerance established in the lung depends only partially on the function of CD4+CD25+Foxp3+ regulatory T cells. PMID: 21518973
  21. Prolonged survival of allografts induced by mycobacterial Hsp70 is dependent on CD4+CD25+ regulatory T cells PMID: 21170379
  22. CD25-expressing activated CD4 cells actively participate in maintaining self-tolerance in the periphery; abnormality of this T cell- mediated immunoregulation can be a common mechanism of various autoimmune diseases. PMID: 21422251
  23. correspond to a discrete innate lymphoid cell population expressing CD25, CCR6 and IL-7R PMID: 21400499
  24. Astragalus membranaceus injection prolonged allograft survival associated with promotion of CD4+ CD25+ Treg activities. PMID: 21094858
  25. Results suggest that CD4+CD25+ Treg cells directly affect cisplatin nephrotoxicity and their modulation represents an additional treatment strategy. PMID: 20463654
  26. Data show that the autoimmune exocrinopathy of the CD25KO LG is composed of a dynamic Th-1 and Th-17 response, with a Th-17 phenotype in young mice shifting to a Th-1-predominant expression at later time points. PMID: 20566743
  27. Data show that CD4(+)IFN-gamma(high)IL-4(low)IL-10(low)TGF-beta(low)FOXp3(-) cells function as antigen-specific regulatory cells that restrain the development of autoimmunity by increasing the threshold of Th17 activation. PMID: 20382706
  28. Transforming growth factor beta and CD25 are important for controlling systemic dissemination following Yersinia enterocolitica infection of the gut. PMID: 20584975
  29. Immunosuppressive agents could be successfully combined with in vitro-expanded CD4+CD25+Foxp3+Treg cell therapy to prevent allograft rejection. PMID: 20305583
  30. prolonged IL-2 signals during priming promote terminal-effector differentiation. PMID: 20096608
  31. Flt3-L significantly inhibited the effect of cockroach antigen sensitization and challenge to increase GATA3 expression in lung CD4(+)CD25(+) T cells. PMID: 19448155
  32. These results indicate that CD4+CD25+Foxp3+ Tregs modify innate immune responses during resolution of lung injury and suggest potential targets for treating acute lung injury. PMID: 19770521
  33. Glutamic acid decarboxylase-derived epitopes with specific domains expand CD4(+)CD25(+) regulatory T cells PMID: 19759824
  34. structural changes within the proximal downregulation of gene expression: structural changes within the enhancer/core promoter during T-cell development PMID: 11972331
  35. data indicate an important role for both AP-1 and NFAT proteins for TCR-induced IL-2Ralpha expression and establish that both upstream and intronic sequences mediate TCR responsiveness of the IL-2Ralpha gene PMID: 12065418
  36. important role of the interleukin-2 receptor beta chain region between the two Stat5 docking sites in induction of interleukin-2 receptor alpha PMID: 12231477
  37. CD25 has a role in c-maf promotion of Th2 cytokine production PMID: 12271139
  38. IL2-R alpha/IL-2 signals are not involved in control of bystander activation, but are instead required for the generation and peripheral expansion and survival of a population of regulatory CD4 T cells essential for peripheral CD4 T cell homeostasis. PMID: 12391195
  39. A TGF-beta-dependent regulatory CD4+ T cell has been identified in an in vivo colitis model that is CD25 negative and latency-associated peptide (LAP) positive. PMID: 12594277
  40. chromatin remodeling of the CD25 locus requires STAT4 and IL-12 PMID: 14660657
  41. functional impairment of the CD4+ CD25+ regulatory T cells in STAT1-deficient animals PMID: 14699080
  42. The T cells exclusively originating from preexisting CD4CD25 regulatory T cells and proves anergic and highly suppressive on isolation. PMID: 15665762
  43. Results suggest that the suppression of myasthenia gravis-associated T cell responses exerted by the dual altered peptide ligand is mediated by the CD4+CD25+ immunoregulatory T cell function. PMID: 15677327
  44. T cells in Peyer patches acquire a similar phenotype to CD4(+) CD25(+) regulatory T cells. PMID: 15681783
  45. self-antigens that elicit naturally occurring CD4(+) CD25(+) T reg cells PMID: 15753203
  46. CD4(+)CD25(+) regulatory T cells develop normally in the absence of TGF-beta1 and retain the ability to suppress colitis in vivo PMID: 15753207
  47. Addition to bone-marrow cultures led to generation of dendritic cells that induced a CD4+CD25+) population inhibiting mixed leukocyte culture. PMID: 15880066
  48. CD4+CD25+ regulatory T cells generated by immunization with these self-antigens enhance susceptibility to 3-methylcholanthrene induced-tumorigenesis by down-regulating iNK T and NK reactivity PMID: 15961541
  49. A CD4+CD25+ regulatory T cell-based mechanism supports the abnormal immune system biology observed in IL-2 receptor alpha knockout mice PMID: 16034141
  50. identifies a novel positive regulatory region in the IL-2Ralpha gene that mediates TGF-beta-dependent induction of the gene; findings have implications related to IL-2Ralpha expression on activated T cells and regulatory T cells PMID: 16087671

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Database Links

KEGG: mmu:16184

STRING: 10090.ENSMUSP00000028111

UniGene: Mm.915

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*