Recombinant Human Interleukin-27 subunit beta (Ebi3),Partial

In Stock
Code CSB-EP007360HU
Abbreviation Recombinant Human EBI3 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Ebi3
Uniprot No.
Research Area
Immunology
Alternative Names
IL-27 subunit beta;IL-27B;Epstein-Barr virus-induced gene 3 protein homolog
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
21-227aa
Target Protein Sequence
RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
54.6 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The process for producing recombinant Human EBI3 protein in e.coli cells follows a sequence of steps: creating the expression vector that codes for the Human EBI3 protein (21-227aa), introducing it into e.coli cells, cultivating and inducing of positive cells for protein expression, lysing cells, and conducting expression analysis. The resultant recombinant Human EBI3 protein is purified from the cell lysate using affinity purification, with its purity exceeding 85%, as determined by SDS-PAGE.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Associates with IL27 to form the IL-27 interleukin, a heterodimeric cytokine which functions in innate immunity. IL-27 has pro- and anti-inflammatory properties, that can regulate T-helper cell development, suppress T-cell proliferation, stimulate cytotoxic T-cell activity, induce isotype switching in B-cells, and that has diverse effects on innate immune cells. Among its target cells are CD4 T-helper cells which can differentiate in type 1 effector cells (TH1), type 2 effector cells (TH2) and IL17 producing helper T-cells (TH17). It drives rapid clonal expansion of naive but not memory CD4 T-cells. It also strongly synergizes with IL-12 to trigger interferon-gamma/IFN-gamma production of naive CD4 T-cells, binds to the cytokine receptor WSX-1/TCCR. Another important role of IL-27 is its antitumor activity as well as its antiangiogenic activity with activation of production of antiangiogenic chemokines.
Gene References into Functions
  1. The IL-35 levels in CagA(+) H. pylori-infected participants from peptic ulcer and H. pylori-infected asymptomatic groups were lower than individuals infected with CagA(-) strains. PMID: 29938865
  2. IL-35 may be involved in the pathogenesis of Primary biliary cirrhosis. PMID: 29445068
  3. IL-35 is a relatively newly discovered member of the IL-12 family which are unique in structure as they are dimer formed by two subunits; recent findings have shown abnormal expression of IL-35 in inflammatory autoimmune diseases and functional analysis suggested that IL-35 is critical in the onset and development of these diseases. [Review] PMID: 29729445
  4. IL-35 expression was significantly increased in patients with chronic hepatitis C and was positively correlated with the levels of viral RNA PMID: 28644966
  5. Pancreatic ductal carcinoma cells produce IL35 to recruit monocytes via CCL5 and induce macrophage to promote angiogenesis via expression of CXCL1 and CXCL8. PMID: 28989066
  6. The study revealed that post-therapeutic recovery of circulating IL-35 concentration might be an independent predictor for effective response to IST in pediatric AA. PMID: 28211781
  7. The plasma levels of interleukin-35 were significantly higher in the hepatocellular carcinoma patients than the controls. PMID: 27699510
  8. this study introduces IL-35 as a new treatment for pemphigus PMID: 27855302
  9. over-expression of EBI3 could reduce the apoptosis of Treg/CD4(+)T/CD8(+)T cells and prevent radiation-induced immunosuppression of cervical cancer HeLa cells by inhibiting the activation of PD-1/PD-L1 signaling pathway PMID: 28351328
  10. Data show that interleukin-35 (Epstein-Barr virus-induced gene 3 (EBI3) and the interleukin-12 Subunit p35 (p35) subunit) levels were significantly elevated in the patients with influenza infection. PMID: 26844658
  11. higher decidual mRNA expression in preeclampsia PMID: 26472010
  12. IL-35 was elevated in bone marrow of adult AML patients and this increase was correlated with the clinical stages of malignancy, suggesting that IL-35 is involved in pathogenesis of AML. PMID: 26431888
  13. Elevated circulating IL-35, particularly at early phase, its decrease after treatment initiation, and a positive association between synovial fluid IL-35 and disease activity support an involvement of IL-35 in the pathogenesis of RA. PMID: 26204444
  14. Data suggest that the toll like receptor 3 (TLR3)-interferon regulatory factor 6 protein (IRF6)-interleukin-23 subunit p19 (p19)/EBI3 protein axis may regulate keratinocyte functions in the skin. PMID: 26303210
  15. EBI3 gene rs4740 polymorphism is closely associated with susceptibility to pulmonary tuberculosis and the elevation and enrichment of EBI3 in the lung derived from macrophages may contribute to the exacerbation of mycobacterial infection. PMID: 25937126
  16. EBI3 Downregulation Contributes to Type I Collagen Overexpression in Scleroderma Skin. PMID: 26355156
  17. IL-35 mRNA and protein were higher in tuberculous pleural effusions than in malignant ones. PMID: 25935866
  18. IL-35 can effectively suppress the proliferation and IL-4 production of activated CD4+CD25- T cells in allergic asthma, and that IL-35 may be a new immunotherapy for asthma patients. PMID: 26044961
  19. IL-35 is highly expressed in chronic HBV CD4(+) T-cells and plays an important role in the inhibition of the cellular immune response in chronic HBV. PMID: 25869609
  20. The levels of EBI3 and IL-12p35 mRNAs in peripheral blood mononuclear cells in moderate or hyper-responders were significantly higher than those in non- or hypo-responders. PMID: 25575066
  21. The results suggest that the decreased expression of IL-35 could be involved in the pathogenesis of childhood asthma. PMID: 24970690
  22. IL-17 and IL-35 may be critically involved in the pathogenesis of hepatitis B-related LC. PMID: 25323532
  23. IL35 appears to contribute to the loss of immunological self-tolerance in ITP patients by modulating T cells and immunoregulatory cytokines. PMID: 25640666
  24. IL-35 levels are dramatically decreased in immune thrombocytopenia patients, suggesting that IL-35 may be involved in the pathogenesis of this disease. PMID: 24994465
  25. Interleukin-35 induces regulatory B cells that suppress autoimmune disease. [il-35] PMID: 24743305
  26. ingestion of apoptotic cells by DCs leads to increased expression of IL-12p35 and Ebi3 without affecting IL-12p40. PMID: 24782489
  27. circulating IL-35 in PDAC patients significantly increased, suggesting that regulating the expression of IL-35 may provide a new possible target for the treatment of PDAC patients, especially for the resectable ones. PMID: 24121041
  28. The increased expression of IL-35 in chronic and aggressive periodontitis suggests its possible role in pathogenesis of periodontitis. PMID: 24376289
  29. EBI3-overexpression in MRL/lpr mice induces generation of regulatory T cells, causing suppression of autoimmune and inflammatory reactions by affecting the T helper (Th)1 cell/Th2 cytokine balance. PMID: 23845089
  30. in contrast to TGF-beta, IL-35 is not constitutively expressed in tissues but it is inducible in response to inflammatory stimuli PMID: 22438968
  31. the findings from the past decade identify IL-27 as a critical immunoregulatory cytokine, especially for T cells, whereas some controversy is fueled by results challenging the view of IL-27 as a classical silencer of inflammation. PMID: 23904441
  32. expressed by trophoblast cells PMID: 23619469
  33. The findings of this study suggest that SNPs in FOXP3 and EBI3 genes modify the risk for development of chronic rhinosinusitis. PMID: 23562195
  34. these results reveal a novel functional role for IL-35 in suppressing cancer activity, inhibiting cancer cell growth, and increasing the apoptosis sensitivity of human cancer cells through the regulation of genes related to the cell cycle and apoptosis. PMID: 23154182
  35. The findings of this study support the potential role of regulatory T cells and genetic variations in the regions around FOXP3 and EBI3 genes in modifying the risk for AR development in Chinese patients. PMID: 22836044
  36. This study demonstrated that interleukin-35 expression could be detected in the CD4(+) T cells from peripheral blood of chronic hepatitis B patients. PMID: 21285006
  37. IL-27 expression is one host immune factor produced in response to influenza A virus infection and that elevated IL-27 levels inhibit viral replication. PMID: 22343630
  38. Data show that Epstein-Barr virus-induced gene 3 (EBI3) is differentially expressed among Burkitt lymphoma and diffuse large B-cell lymphoma. PMID: 21931777
  39. a new heterodimeric cytokine that consists of EBI3, an IL-12p40-related protein, and p28, a newly discovered IL-12p35-related polypeptide (IL-27) PMID: 12121660
  40. results suggest that increased numbers of Epstein-Barr virus-infected cells in areas of active inflammatory bowel disease are secondary to influx or local proliferation of inflammatory cells & do not contribute significantly to local production of EBI3 PMID: 15170639
  41. findings indicate that the restricted Th1 responses in newborns owing to deficient IL-12 production may be compensated for, in part, by enhanced IL-27 secretion PMID: 18167155
  42. The genome-wide mRNA expression profile under the condition of short-term stimulation (4h) with IL-18 using the Affymetrix GeneChip((R)) Array System, was characterized. PMID: 18336908
  43. Our data support a possible role of Ebi3 in atherogenesis PMID: 19556516

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Type I cytokine receptor family, Type 3 subfamily
Database Links

HGNC: 3129

OMIM: 605816

KEGG: hsa:10148

STRING: 9606.ENSP00000221847

UniGene: Hs.501452

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*