Recombinant Mouse Kallikrein-8 (Klk8)

In Stock
Code CSB-EP720268MO
Abbreviation Recombinant Mouse Klk8 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Klk8
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Klk8; Nrpn; Prss19Kallikrein-8; mK8; EC 3.4.21.118; Neuropsin; NP; Serine protease 19
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
33-260aa
Target Protein Sequence
ILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSLQSRDQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDPCGKPEKPGVYTKICRYTTWIKKTMDNRD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.1kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The region for expressing recombinant Mouse Klk8 contains amino acids 33-260. The theoretical molecular weight of the Klk8 protein is 29.1 kDa. The Klk8 protein was expressed in e.coli. Fusion of the N-terminal 6xHis tag into the Klk8 encoding gene fragment was conducted, allowing for easier detection and purification of the Klk8 protein in subsequent stages.

Mouse kallikrein-8 (Klk8) is a serine protease mainly involved in the regulation of skin desquamation and antimicrobial defense through proteolytic activity. Studying Klk8 provides insights into skin homeostasis, neurobiology, and cancer biology, offering potential applications in dermatology, neurodegenerative disease research, and cancer therapy. In neuroscience, Klk8 participates in synaptic plasticity and cognitive function. Its dysregulation is associated with neurodegenerative disorders. In cancer research, Klk8 is a potential biomarker for ovarian and breast cancers. Understanding Klk8's multifaceted roles contributes to advancements in various research areas and offers avenues for therapeutic interventions in relevant physiological and pathological conditions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV. Also cleaves L1CAM in response to increased neural activity. Induces neurite outgrowth and fasciculation of cultured hippocampal neurons. Plays a role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus and is required for memory acquisition and synaptic plasticity. Involved in skin desquamation and keratinocyte proliferation. Plays a role in the secondary phase of pathogenesis following spinal cord injury.
Gene References into Functions
  1. Letter: NGF-p75 and neuropsin/KLK8 pathways may cooperate in regulation of epidermal homeostasis in inflamed skin. PMID: 22520925
  2. Klk8 is involved in the proliferation and migration of keratinocytes through Klk6 in the early stages of wound healing, and possibly in keratinocyte differentiation associated with the upregulation of PAR2 in the late stages of wound healing. PMID: 22358061
  3. KLK8 is involved in synaptic tagging during LTP at basal and apical dendritic inputs. PMID: 21646406
  4. the serine protease neuropsin is critical for stress-related plasticity in the amygdala by regulating the dynamics of the EphB2-NMDA-receptor interaction, the expression of Fkbp5 and anxiety-like behaviour PMID: 21508957
  5. Klk8 might thus be involved in tissue development and rearrangement. PMID: 20180635
  6. role of loop structures in the activity of serine protease and regulated secretion PMID: 11854276
  7. Neuropsin was localized extracellularly in neuronal cell bodies and their neurites in mouse hippocampus. Neuropsin may be involved in neurite outgrowth during the development of the nervous system. PMID: 11880192
  8. gene expression of a serine-protease neuropsin in the mouse vagina, and as a marker of the estrogen-independent persistent proliferation and cornification of the vaginal epithelium PMID: 12354676
  9. Neuropsin is the first extracellular protease to show the evident induction of expression and activity by decidualization and might contribute to the remodeling of extracellular components after decidualization. PMID: 12390870
  10. mouse MCs store at least two distinct families of tryptic-like proteases in their secretory granules, including PRSS19 PMID: 12646205
  11. Presynaptic adhesion molecule L1 is a substrate for neuropsin in the hippocampus. PMID: 12944500
  12. study demonstrates changes in the expression of neuropsin and protease M/neurosin in oligodendrocytes following hemisection of the spinal cord PMID: 15378660
  13. Neuropsin-/- mice showed attenuated demyelination and delayed oligodendroglial death early during the course of autoimmune encephalomyelitis PMID: 15920728
  14. Nrpn is necessary for establishment of LTP and has a significant role in memory acquisition. PMID: 16308352
  15. These observations suggest that neuropsin is involved in the secondary phase of the pathogenesis of SCI mediated by demyelination, oligodendrocyte death, and axonal degeneration. PMID: 17629414
  16. Neuropsin-dependent late associativity is particularly important in nonstressful associative memory. PMID: 18216192
  17. Increased anxiety-like behavior in neuropsin (kallikrein-related peptidase 8) gene-deficient mice. PMID: 18513120

Show More

Hide All

Subcellular Location
Secreted. Cytoplasm. Note=Shows a cytoplasmic distribution in the keratinocytes.
Protein Families
Peptidase S1 family, Kallikrein subfamily
Tissue Specificity
Expressed in the limbic system of mouse brain and is localized at highest concentration in pyramidal neurons of the hippocampal CA1-3 subfields. Also detected in spinal cord gray matter and in keratinized stratified epithelia of epidermis, hair, tongue, p
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*