Recombinant Mouse Lactotransferrin (Ltf)

Code CSB-YP013229MO
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP013229MO
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP013229MO-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP013229MO
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP013229MO
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Ltf
Uniprot No.
Alternative Names
Ltf; Lactotransferrin; Lactoferrin; EC 3.4.21.-
Species
Mus musculus (Mouse)
Expression Region
20-707
Target Protein Sequence
KATTVQWCAVSNSEEEKCLRWQNEMRKVGGPPLSCVKKSSTRQCIQAIVTNRADAMTLDG GTMFDAGKPPYKLRPVAAEVYGTKEQPRTHYYAVAVVKNSSNFHLNQLQGLRSCHTGIGR SAGWKIPIGTLRPYLNWNGPPASLEEAVSKFFSKSCVPGAQKDRFPNLCSSCAGTGANKC ASSPEEPYSGYAGALRCLRDNAGDVAFTRGSTVFEELPNKAERDQYKLLCPDNTWKPVTE YKECHLAQVPSHAVVSRSTNDKEEAIWELLRQSQEKFGKKQASGFQLFASPSGQKDLLFK ESAIGFVRVPQKVDVGLYLTFSYTTSIQNLNKKQQDVIASKARVTWCAVGSEEKRKCDQW NRASRGRVTCISFPTTEDCIVAIMKGDADAMSLDGGYIYTAGKCGLVPVLAENQKSSKSN GLDCVNRPVEGYLAVAAVRREDAGFTWSSLRGKKSCHTAVDRTAGWNIPMGLLANQTRSC KFNEFFSQSCAPGADPKSNLCALCIGDEKGENKCAPNSKERYQGYTGALRCLAEKAGNVA FLKDSTVLQNTDGKNTEEWARNLKLKDFELLCLDDTRKPVTEAKNCHLAIAPNHAVVSRT DKVEVLQQVLLDQQVQFGRNGQRCPGEFCLFQSKTKNLLFNDNTECLAKIPGKTTSEKYL GKEYVIATERLKQCSSSPLLEACAFLTQ
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Related Products

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate.; Lactotransferrin is a major iron-binding and multifunctional protein found in exocrine fluids such as breast milk and mucosal secretions. Has antimicrobial activity. Antimicrobial properties may include bacteriostasis, which is related to its ability to sequester free iron and thus inhibit microbial growth, as well as direct bactericidal properties leading to the release of lipopolysaccharides from the bacterial outer membrane. May have anabolic, differentiating and anti-apoptotic effects on osteoblasts and may also inhibit osteoclastogenesis, possibly playing a role in the regulation of bone growth. May interfere with the lipopolysaccharide (LPS)-stimulated TLR4 signaling.; The lactotransferrin transferrin-like domain 1 functions as a serine protease of the peptidase S60 family that cuts arginine rich regions. This function contributes to the antimicrobial activity. Shows a preferential cleavage at -Arg-Ser-Arg-Arg-|- and -Arg-Arg-Ser-Arg-|-, and of Z-Phe-Arg-|-aminomethylcoumarin sites.
Gene References into Functions
  1. Hepatic Ltf prevents hepatic steatosis through inhibition of dietary lipid uptake in radiation-induced NAFLD mouse model. We also suggest coumestrol as a drug candidate for prevention of NAFLD. PMID: 29975946
  2. Data indicate that lactoferrin uptake across duodenum by glyceraldehyde-3-phosphate dehydrogenase (GAPDH). PMID: 26672975
  3. HA and LF act in synergism in the regulation of the bone homeostasis, working as anabolic factor for osteoblasts differentiation and bone matrix deposition, and as inhibitor of the osteoclast formation and activity. PMID: 26148296
  4. Results show that LTF gene expression is downregulated in colorectal cancer tumors and its knock out in mouse model of colitis-associated colorectal dysplasia suggests its protective role in colorectal mucosal immunity and inflammation. PMID: 25057912
  5. Data show that the expression of several genes encoding salivary antimicrobial proteins, such as secretory leukocyte peptidase inhibitor (SLPI), S100A8, and lactotransferrin, was reduced due to myeloid differentiation dactor 88 (MyD88) deficiency. PMID: 25415419
  6. Lactoferrin dampens high-fructose corn syrup-induced hepatic manifestations of the metabolic syndrome in a murine model. PMID: 24816278
  7. We conclude that lactotransferrin represents a late stage differentiation marker of neutrophils, macrophages and distinct subtypes of dendritic cells. PMID: 24561791
  8. The variations in lactoferrin expression levels during developmental stages may be related to its regulatory role in mouse mammary gland immunity. PMID: 25062410
  9. the present work indicated that LF stimulated MC3T3-E1 preosteoblast differentiation mainly through LRP1-independent PKA and p38 signaling pathways. PMID: 24877241
  10. Studie indicate that in iCre knock-in line, the iCre is expressed from endogenous lactoferrin (Ltf) promoter. PMID: 24823394
  11. the homologous LF elicits significant and transient myelopoiesis in experimental mice. PMID: 23879888
  12. administration of lactoferrin led to autopotentiated increased expression of the LTF gene. The decreased lactoferrin mRNA levels in association with obesity and diabetes were replicated in mice adipose tissue PMID: 23333090
  13. The up-regulation of lactorferrin in the brains of the transgenic mouse model of Alzheimer's disease provides evidence of an important role for lactoferrin in alzheimer disease-affected brain tissues PMID: 20599473
  14. Methoxychlor stimulates the mouse lactoferrin gene promoter through a GC-rich element. PMID: 11908639
  15. differential expression and estrogen responsiveness of the lactoferrin gene in different regions of the female reproductive tract PMID: 12390874
  16. these results support the conclusion that lactoferrin does not play a major role in the regulation of iron homeostasis PMID: 12482971
  17. the concentrations of ceruloplasmin and lactoferrin in milk were increased fivefold and more than 38-fold, respectively, within 48 h after weaning PMID: 16989572
  18. These results indicate that although LF deficiency alone is not a primary cause of the defects associated with specific granule deficiency, this protein does play an immunomodulatory role in the oxidative burst response of neutrophils. PMID: 18321995
  19. lactoferrin has multifunctional antiprion activities. PMID: 18717818
  20. This study reports that a novel glycosylphosphatidylinositol (GPI)-anchored lactoferrin CSP82 on uninitiated mouse bone marrow cells may be involved in inducing pro-dendritic cells from common myeloid progenitor. PMID: 19524877

Show More

Hide All

Subcellular Location
Secreted. Cytoplasmic granule.
Protein Families
Transferrin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×