Home
Protein
Recombinant Proteins
Recombinant Mouse Leukocyte cell-derived chemotaxin-2 (Lect2)

Recombinant Mouse Leukocyte cell-derived chemotaxin-2 (Lect2)

^{In Stock}

Code	CSB-YP012855MO
Abbreviation	Recombinant Mouse Lect2 protein
MSDS	MSDS Datasheet
Size	$436
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Lect2

Uniprot No.

O88803

Research Area

Developmental Biology

Alternative Names

LECT-2;Chondromodulin II;ChM-II

Species

Mus musculus (Mouse)

Source

Yeast

Expression Region

19-151aa

Target Protein Sequence

GPWANICASKSSNEIRTCDSYGCGQYSAQRTQRHHPGVDVLCSDGSVVYAPFTGKIVGQEKPYRNKNAINDGIRLSGRGFCVKIFYIKPIKYKGSIKKGEKLGTLLPLQKIYPGIQSHVHVENCDSSDPTAYL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

18.4 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 6xHis-Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Strengthen your developmental biology investigations with our Recombinant Mouse Lect2, also known as Leukocyte cell-derived chemotaxin-2. This yeast-expressed protein plays an essential role in several biological pathways including cell migration, immune responses, and skeletal development.

Our Lect2 offers the full length of the mature protein (19-151aa), providing a complete perspective of its structure and function. The protein is expressed with a C-terminal 6xHis-Myc tag, aiding in efficient purification and robust stability. Our Recombinant Mouse Lect2 adheres to the strictest quality standards, with a purity of over 90% as determined by SDS-PAGE. Choose between liquid form for immediate use or lyophilized powder for convenient long-term storage, facilitating your research progression.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Has a neutrophil chemotactic activity. Also a positive regulator of chondrocyte proliferation.

Gene References into Functions

This study demonstrates the rapid response of LECT2 preceding body weight alterations during weight cycling in mice. PMID: 27562717
We found that treatment with LECT2 enhanced H. pylori killing and nitric oxide production in macrophages. In addition, DNA-binding activity and nuclear translocation of p65 were up-regulated by LECT2 treatment PMID: 27813598
LECT2 is regulated by beta-catenin in HCC in both mice and men, but serum LECT2 reflects beta-catenin activity only in mice. Serum LECT2 could be a potential biomarker of HCC in patients. PMID: 24892551
LECT2 improves protective immunity in bacterial sepsis, possibly as a result of enhanced macrophages functions via the CD209a receptor. PMID: 23254286
Zinc stabilizes the LECT2 structure. PMID: 23352894
Data suggest the involvement of LECT2 in the regulation of fatal SEA-induced toxicity in d-GalN-sensitized mice. PMID: 20805039
Our results suggest that LECT2 regulates neuritic extension through microtubular morphallaxis through the control of katanin-P60 levels. PMID: 20463617
Our results show that LECT2 regulates the extension of axons and dendrites and the expressions of NGF, BDNF and NT-3 during neuronal development. PMID: 19917270
LECT2, which encodes a protein with chemotactic properties for human neutrophils, is a direct target gene of Wnt/beta-catenin signaling in the liver. PMID: 15239100
Triggers the early events of liver regeneration with concomitant suppression of hepatocyte proliferation. PMID: 18000337
LECT2 directly suppresses the development of collagen antibody induced arthritis PMID: 18240267