Recombinant Mouse Mucin-1 (Muc1), partial

In Stock
Code CSB-EP312543MO
Abbreviation Recombinant Mouse Muc1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
MUC-1;Episialin;CD antigen CD227;MUC1-NT;MUC1-alpha;MUC1-beta;MUC1-CT
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
21-535aa
Target Protein Sequence
FLALPSEENSVTSSQDTSSSLASTTTPVHSSNSDPATRPPGDSTSSPVQSSTSSPATRAPEDSTSTAVLSGTSSPATTAPVNSASSPVAHGDTSSPATSLSKDSNSSPVVHSGTSSAATTAPVDSTSSPVVHGGTSSPATSPPGDSTSSPDHSSTSSPATRAPEDSTSTAVLSGTSSPATTAPVDSTSSPVAHDDTSSPATSLSEDSASSPVAHGGTSSPATSPLRDSTSSPVHSSASIQNIKTTSDLASTPDHNGTSVTTTSSALGSATSPDHSGTSTTTNSSESVLATTPVYSSMPFSTTKVTSGSAIIPDHNGSSVLPTSSVLGSATSLVYNTSAIATTPVSNGTQPSVPSQYPVSPTMATTSSHSTIASSSYYSTVPFSTFSSNSSPQLSVGVSFFFLSFYIQNHPFNSSLEDPSSNYYQELKRNISGLFLQIFNGDFLGISSIKFRSGSVVVESTVVFREGTFSASDVKSQLIQHKKEADDYNLTISEVKVNEMQFPPSAQSRPGVPGWG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
53.0 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The alpha subunit has cell adhesive properties. Can act both as an adhesion and an anti-adhesion protein. May provide a protective layer on epithelial cells against bacterial and enzyme attack.; The beta subunit contains a C-terminal domain which is involved in cell signaling, through phosphorylations and protein-protein interactions. Modulates signaling in ERK, Src and NF-kappaB pathways. In activated T-cells, influences directly or indirectly the Ras/MAPK pathway. Regulates P53-mediated transcription and determines cell fate in the genotoxic stress response. Binds, together with KLF4, the PE21 promoter element of P53 and represses P53 activity.
Gene References into Functions
  1. The results showed that co-administration of an adjuvant plasmid and a DNA vaccine stimulated the production of higher titers of specific antibodies and a T cell response and suppressed the growth of subcutaneous tumors expressing MUC1. PMID: 30111221
  2. these data showed that sustained abnormal MUC1 induction accompanies failing epithelial repair, chronic inflammation and kidney fibrosis. In conclusion, MUC1 exerts opposite effects during kidney response to IR: first protective and then harmful PMID: 28366875
  3. MUC1 plays an important role in protection against severe pneumococcal disease, potentially mediated by facilitating macrophage phagocytosis. PMID: 28605238
  4. this study implicates the MUC1 as a critical and dynamic component of the innate host response that limits the severity of influenza and provides the foundation for exploration of MUC1 in resolving inflammatory disease PMID: 28327617
  5. Muc1 has anti-fibrotic properties in the mouse lung. PMID: 28916165
  6. our data suggest a novel molecular mechanism by which tMUC1 may modulate NRP1-dependent VEGFR signaling in PDA cells. PMID: 26804176
  7. Low expression of MUC1 is associated with lung carcinogenesis. PMID: 28472347
  8. Gp91phox NADPH oxidase modulates litter size by up-regulating mucin1 expression in the uterus of mice. PMID: 28301257
  9. In summary, we have demonstrated that MUC1 on immune cells is a novel regulator of the NLRP3 inflammasome, and propose this is mediated by an interaction with signalling components at the cytoplasmic domains of TLRs that involves inhibition of IRAK4 activation. PMID: 26079943
  10. MUC1 regulates IL-1beta secretion induced by the NLRP3-activating bacteria Haemophilus influenzae but not bacteria that activate other inflammasomes. PMID: 26938663
  11. Muc1 protection during acute kidney injury proceeds by enhancing both the HIF-1 and beta-catenin protective pathways. PMID: 26739894
  12. MAMs MUC1 and MUC16 contribute to the maintenance of immune homeostasis at the ocular surface by limiting TLR-mediated innate immune responses. PMID: 25563498
  13. the present study provides evidence that Muc1 is a direct target of let-7a and let-7b in mouse uteri during embryo implantation. PMID: 25739861
  14. Muc1 clearly plays a significant role in enhancing the hypoxia-inducible transcription factors protective pathway during ischemic insult and recovery in kidney epithelia PMID: 25925251
  15. Epithelial Muc1 is important for gastric mucosa healing by enhancing cell migration and proliferation. PMID: 25387004
  16. the present study provides evidence that MUC1 is a direct target of miRNA-199a during embryo implantation. PMID: 23759257
  17. Helicobacter pylori infection is the most definite insult leading to gastric cancer, and a protective function of mucin 1 protein has been suggested by studies on Muc1 knocked-out mice. PMID: 24810688
  18. These results suggest that sSiglec-9 has an antitumor benefit against MUC1-expressing tumor in the transgenic mice. PMID: 24924635
  19. Downregulation of hematopoietic MUC1 during experimental colitis increases tumor-promoting myeloid-derived suppressor cells. PMID: 23873692
  20. MUC1 overexpression in alveolar epithelial cells does not account for the anti-inflammatory effects of the NSAID, Tanshinone IIA, in the airway. PMID: 24153432
  21. Siglec-9 expressed on immune cells may play a role as a potential counterreceptor for MUC1 and that this signaling may be another MUC1-mediated pathway and function in parallel with a growth factor-dependent pathway. PMID: 24045940
  22. This is the first report demonstrating the possible involvement of Muc1 in the development of multiple sclerosis and might provide a potential target for immunotherapy PMID: 23261777
  23. MUC1c regulates cell survival in pancreatic cancer by preventing lysosomal permeabilization. PMID: 22912777
  24. diabetic NOD mice overexpressed MUC1 mucin at embryo implantation sites PMID: 22539679
  25. MUC1 may play a crucial role in the resolution of inflammation during chronic respiratory infections, and MUC1 dysfunction likely contributes to the pathogenesis of chronic inflammatory respiratory disease PMID: 22643830
  26. MUC1 mucin stabilizes and activates hypoxia-inducible factor 1 alpha to regulate metabolism in pancreatic cancer PMID: 22869720
  27. Muc1, which is up-regulated by Th17 signaling, functions in a negative feedback pathway that prevents an excessive Th17 cell response in inflamed colons of mice. PMID: 22202458
  28. MUC1 protein expression in tumor cells regulates transcription of proinflammatory cytokines by forming a complex with nuclear factor-kappaB p65 and binding to cytokine promoters PMID: 22021035
  29. These data suggest that Muc1 may contribute to a physical barrier that protects against mouse adenovirus type 1 respiratory infection. PMID: 21816184
  30. data indicate a critical role for MUC1-CD in the development of mammary gland preneoplasia and tumorigenesis, suggesting MUC1-CD as a potential target for the diagnosis and chemoprevention of human breast cancer PMID: 21533058
  31. Soy protein diet, but not Lactobacillus rhamnosus GG, decreases mucin-1, trefoil factor-3, and tumor necrosis factor-alpha in colon of dextran sodium sulfate-induced colitis. PMID: 21593350
  32. the up-regulation of Muc1 during airway P. aeruginosa infection might be crucial for suppressing excessive and prolonged inflammatory responses, and is induced mainly by TNF-alpha, the key proinflammatory mediator PMID: 20448050
  33. Data suggest that pancreatitis is an extraintestinal site of IBD, characterized by proinflammatory abnormal expression of MUC1. PMID: 20084048
  34. Muc1 binds to IKKgamma, thereby inhibiting formation of the catalytically active IKK complex and blocking the ability of Helicobacter pylori to stimulate IkappaBalpha phosphorylation. PMID: 20430889
  35. Our results indicate that deletion of Muc1 promotes a heightened functional response of DC in response to TLR4 and TLR5 signaling pathways, and suggests a previously under-appreciated role for Muc1 in regulating innate immune responses of DC. PMID: 20375631
  36. This is the first demonstration showing that MUC1 can suppress the virus-induced inflammatory responses. PMID: 20081068
  37. MUC1 is a substrate for gamma-secretase PMID: 19711367
  38. anti-MUC1 antibodies and Foxp3+ regulatory T cells are present in a mouse model for human MUC1-positive endometriosis PMID: 19841240
  39. The -750 and -250 regions are conserved between the human MUC1 and mouse Muc1 genes and may be associated with functionally important genetic elements. PMID: 11984004
  40. MUC1-specific anti-tumor responses: molecular requirements for CD4-mediated responses PMID: 12147624
  41. CD227 is expressed on human and murine activated dendritic cells PMID: 12377938
  42. MUC1 expression is increased, and it appears that alternate cytoplasmic tails may change its role in signaling in CFTR-deficient mice; MUC1 could be an important contributor to the CF intestinal phenotype PMID: 12529261
  43. Analysis of MMTV-Wnt-1 tumors on a wild-type Muc1 background shows a tumor-specific complex formation between Muc1 and beta-catenin that can be observed in both the membrane and the cytoplasm of transformed epithelium. PMID: 12618757
  44. decreased gallstone formation in mice with disrupted Muc1 gene results from reduced mucin secretion and accumulation in the gallbladder PMID: 14703511
  45. activation of ErbB2, which only occurs in c-Neu tumors, selectively inhibits Muc1 expression PMID: 14737104
  46. Our results indicate that, T cell responses necessary for protection against MUC1-expressing tumours that are induced by IM injection of MUC1 cDNA are independent of the tandem repeat domain as well as the transmembrane and cytoplasmic domains. PMID: 14999776
  47. physiological levels of the epithelial mucin produced by the Muc1 gene are necessary for normal intestinal uptake and absorption of cholesterol in mice PMID: 15075252
  48. Several genes are up-regulated by MUC1/sec expression, including MCP-1 (CCL-2). PMID: 15265901
  49. PPAR gamma controls Muc1 transcription in trophoblasts. PMID: 15572671
  50. The results suggest that MUC1 is not a major component in the accumulated mucus of CF mice and that MUC1 can influence the amount of other mucins in a still unknown way. PMID: 16500918

Show More

Hide All

Subcellular Location
Apical cell membrane; Single-pass type I membrane protein.; [Mucin-1 subunit beta]: Cell membrane. Cytoplasm. Nucleus.
Tissue Specificity
Expressed in a variety of epithelial tissues.
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*