Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Nptx1

Uniprot No.

Q62443

Research Area

Neuroscience

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

23-432aa

Target Protein Sequence

QDFGPTRFICTSVPVDADMCAASVAAGGAEELRSNVLQLRETVLQQKETILSQKETIRELTTKLGRCESQSTLDSGPGEARSGGGRKQPGSGKNTMGDLSRTPAAETLSQLGQTLQSLKTRLENLEQYSRLNSSSQTNSLKDLLQSKIDDLERQVLSRVNTLEEGKGGPKNDTEERAKIESALTSLHQRISELEKGQKDNRPGDKFQLTFPLRTNYMYAKVKKSLPEMYAFTVCMWLKSSAAPGVGTPFSYAVPGQANELVLIEWGNNPMEILINDKVAKLPFVINDGKWHHICVTWTTRDGVWEAYQDGTQGGNGENLAPYHPIKPQGVLVLGQEQDTLGGGFDATQAFVGELAHFNIWDRKLTPGEVYNLATCSSKALSGNVIAWAESQIEIFGGATKWTFEACRQIN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

49.1 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The expression region of this recombinant Mouse Nptx1 covers amino acids 23-432. The theoretical molecular weight of the Nptx1 protein is 49.1 kDa. This Nptx1 recombinant protein is manufactured in e.coli. The Nptx1 coding gene included the N-terminal 6xHis tag, which simplifies the detection and purification processes of the recombinant Nptx1 protein in following stages of expression and purification.

The mouse neuronal Pentraxin-1 (Nptx1) is a member of the pentraxin family of proteins primarily expressed in the central nervous system, particularly in neurons. Nptx1 is involved in synaptic plasticity and is known to play a role in the modulation of excitatory synapses. It interacts with the neuronal pentraxin receptor (NPTXR), influencing the development and maintenance of excitatory synapses. Nptx1 has been implicated in various neurological processes, including learning and memory. Its ability to regulate synaptic function suggests its significance in neuronal communication and network activity. Understanding the functions of Nptx1 can provide insights into the molecular mechanisms underlying synaptic plasticity and contribute to the knowledge of neurodevelopmental and neurodegenerative disorders.

Target Background

Function

May be involved in mediating uptake of synaptic material during synapse remodeling or in mediating the synaptic clustering of AMPA glutamate receptors at a subset of excitatory synapses.

Gene References into Functions

Neuronal pentraxin 1 accumulates on the postsynaptic terminal forming functional synapses. PMID: 29024665
work highlights a potential role for synaptic proteins, such as NP1 and glutamate receptors in lysosomal storage diseases. PMID: 28007910
Results demonstrate a novel mechanism of neuronal death and predict that inhibition of NP1 expression is a promising strategy to prevent hypoxic-ischemic injury in immature brain PMID: 25554688
results demonstrate that extracellular release of NP1 promote hypoxic-ischemic neuronal death possibly via surface clustering with GluR1 at synaptic sites and that NP1, not its family member NP2, is involved in the neuronal death mechanisms PMID: 25526743
Genetic deletion of NP1 prevents hypoxic-ischemic neuronal death by reducing synaptic clustering of GluR1. PMID: 23525449
These findings suggest that Narp in the mPFC mediates the extinction of morphine conditioned place preference. PMID: 23322555
our findings demonstrate a novel mechanism by which NP1 regulates mitochondria-driven hippocampal cell death PMID: 23069675
NP1 facilitates the accumulation of BCL2-associated X protein (BAX) in mitochondria and regulates mitochondrial dynamics during apoptosis in mouse cerebellar granule neurons in culture. PMID: 22279230
Neuronal pentraxin 1 induction in hypoxic-ischemic neuronal death is regulated via a glycogen synthase kinase-3alpha/beta dependent mechanism PMID: 21130869
data indicate that the loss of NP1/2 disrupts several aspects of retinogeniculate development including the initial establishment of AMPAR transmission and the subsequent elimination of inappropriate circuit connections PMID: 20392962
The Id3 and NP1 genes become transcriptionally active after MyoD induction in undifferentiated myoblasts. This is a stable, heritable event that does not need continued MyoD activity & is not subject to negative regulation by activated H-Ras G12V. PMID: 12167713
Neuronal pentraxin 1 and 2 are necessary for early synaptic refinements in mammalian retina and dorsal lateral geniculate nucleus. May exert their effects through mechanisms paralleling known role of short pentraxins outside the CNS. (Pentraxin 1 and 2) PMID: 16763034
Neuronal activity regulated pentraxin has a selective role in processing sensory-specific information necessary for appropriate devaluation performance, but not in general motivational effects of reward-predictive cues on performance. PMID: 18057201
NP1 enhances synaptogenesis and glutamate signaling by clustering AMPA receptors. PMID: 18840757

Hide All

Subcellular Location

Cytoplasmic vesicle, secretory vesicle.

Database Links

KEGG: mmu:18164

STRING: 10090.ENSMUSP00000026670

UniGene: Mm.5142

Code	CSB-EP714021MO
Abbreviation	Recombinant Mouse Nptx1 protein
MSDS	MSDS Datasheet
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Neuronal pentraxin-1 (Nptx1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage