Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Neuroscience
Species
Mus musculus (Mouse)
Expression Region
23-432aa
Target Protein Sequence
QDFGPTRFICTSVPVDADMCAASVAAGGAEELRSNVLQLRETVLQQKETILSQKETIRELTTKLGRCESQSTLDSGPGEARSGGGRKQPGSGKNTMGDLSRTPAAETLSQLGQTLQSLKTRLENLEQYSRLNSSSQTNSLKDLLQSKIDDLERQVLSRVNTLEEGKGGPKNDTEERAKIESALTSLHQRISELEKGQKDNRPGDKFQLTFPLRTNYMYAKVKKSLPEMYAFTVCMWLKSSAAPGVGTPFSYAVPGQANELVLIEWGNNPMEILINDKVAKLPFVINDGKWHHICVTWTTRDGVWEAYQDGTQGGNGENLAPYHPIKPQGVLVLGQEQDTLGGGFDATQAFVGELAHFNIWDRKLTPGEVYNLATCSSKALSGNVIAWAESQIEIFGGATKWTFEACRQIN
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The expression region of this recombinant Mouse Nptx1 covers amino acids 23-432. The theoretical molecular weight of the Nptx1 protein is 49.1 kDa. This Nptx1 recombinant protein is manufactured in e.coli. The Nptx1 coding gene included the N-terminal 6xHis tag, which simplifies the detection and purification processes of the recombinant Nptx1 protein in following stages of expression and purification.
The mouse neuronal Pentraxin-1 (Nptx1) is a member of the pentraxin family of proteins primarily expressed in the central nervous system, particularly in neurons. Nptx1 is involved in synaptic plasticity and is known to play a role in the modulation of excitatory synapses. It interacts with the neuronal pentraxin receptor (NPTXR), influencing the development and maintenance of excitatory synapses. Nptx1 has been implicated in various neurological processes, including learning and memory. Its ability to regulate synaptic function suggests its significance in neuronal communication and network activity. Understanding the functions of Nptx1 can provide insights into the molecular mechanisms underlying synaptic plasticity and contribute to the knowledge of neurodevelopmental and neurodegenerative disorders.
