Recombinant Mouse Nuclear receptor ROR-gamma (Rorc)

Code CSB-YP020071MO
Abbreviation Recombinant Mouse Rorc protein
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
Rorc; Nr1f3; Rorg; Thor; Nuclear receptor ROR-gamma; Nuclear receptor RZR-gamma; Nuclear receptor subfamily 1 group F member 3; RAR-related orphan receptor C; Retinoid-related orphan receptor-gamma; Thymus orphan receptor; TOR
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
1-516aa
Target Protein Sequence
MDRAPQRHHRTSRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQCNVAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQQQQQEQVAKTPPAGSRGADTLTYTLGLSDGQLPLGASPDLPEASACPPGLLRASGSGPPYSNTLAKTEVQGASCHLEYSPERGKAEGRDSIYSTDGQLTLGRCGLRFEETRHPELGEPEQGPDSHCIPSFCSAPEVPYASLTDIEYLVQNVCKSFRETCQLRLEDLLRQRTNLFSREEVTSYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIILLTAGAMEVVLVRMCRAYNANNHTVFFEGKYGGVELFRALGCSELISSIFDFSHFLSALCFSEDEIALYTALVLINANRPGLQEKRRVEHLQYNLELAFHHHLCKTHRQGLLAKLPPKGKLRSLCSQHVEKLQIFQHLHPIVVQAAFPPLYKELFSTDVESPEGLSK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
60.1kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Nuclear receptor that binds DNA as a monomer to ROR response elements (RORE) containing a single core motif half-site 5'-AGGTCA-3' preceded by a short A-T-rich sequence. Key regulator of cellular differentiation, immunity, peripheral circadian rhythm as well as lipid, steroid, xenobiotics and glucose metabolism. Considered to have intrinsic transcriptional activity, have some natural ligands like oxysterols that act as agonists (25-hydroxycholesterol) or inverse agonists (7-oxygenated sterols), enhancing or repressing the transcriptional activity, respectively. Recruits distinct combinations of cofactors to target gene regulatory regions to modulate their transcriptional expression, depending on the tissue, time and promoter contexts. Regulates the circadian expression of clock genes such as CRY1, ARNTL/BMAL1 and NR1D1 in peripheral tissues and in a tissue-selective manner. Competes with NR1D1 for binding to their shared DNA response element on some clock genes such as ARNTL/BMAL1, CRY1 and NR1D1 itself, resulting in NR1D1-mediated repression or RORC-mediated activation of the expression, leading to the circadian pattern of clock genes expression. Therefore influences the period length and stability of the clock. Involved in the regulation of the rhythmic expression of genes involved in glucose and lipid metabolism, including PLIN2 and AVPR1A. Negative regulator of adipocyte differentiation through the regulation of early phase genes expression, such as MMP3. Controls adipogenesis as well as adipocyte size and modulates insulin sensitivity in obesity. In liver, has specific and redundant functions with RORA as positive or negative modulator of expression of genes encoding phase I and Phase II proteins involved in the metabolism of lipids, steroids and xenobiotics, such as SULT1E1. Also plays also a role in the regulation of hepatocyte glucose metabolism through the regulation of G6PC1 and PCK1. Regulates the rhythmic expression of PROX1 and promotes its nuclear localization.; Essential for thymopoiesis and the development of several secondary lymphoid tissues, including lymph nodes and Peyer's patches. Required for the generation of LTi (lymphoid tissue inducer) cells. Regulates thymocyte survival through DNA-binding on ROREs of target gene promoter regions and recruitment of coactivaros via the AF-2. Also plays a key role, downstream of IL6 and TGFB and synergistically with RORA, for lineage specification of uncommitted CD4(+) T-helper (T(H)) cells into T(H)17 cells, antagonizing the T(H)1 program. Probably regulates IL17 and IL17F expression on T(H) by binding to the essential enhancer conserved non-coding sequence 2 (CNS2) in the IL17-IL17F locus. May also play a role in the pre-TCR activation cascade leading to the maturation of alpha/beta T-cells and may participate in the regulation of DNA accessibility in the TCR-J(alpha) locus. Plays an indispensable role in the induction of IFN-gamma dependent anti-mycobacterial systemic immunity.
Gene References into Functions
  1. Generation of RORgammat(+) antigen-specific T17 regulatory cells from Foxp3(+) precursors in autoimmunity has been described. PMID: 28978473
  2. the potential effects of the A2A adenosine receptor (A2AR) antagonist SCH 5826 (SCH) and agonist CGS 21680 (CGS) on behavior (self-grooming), hot plate test results, and expression levels of IL-17A(+), RORgammat(+), Foxp3(+), and IL-10(+) in CD4(+) T spleen cells in BTBR and C57BL/6 (B6) mice, were investigated. PMID: 28438638
  3. pharmacological inhibition of RORgamma skews TCRalpha gene rearrangement, limits T cell repertoire diversity, and inhibits development of autoimmune encephalomyelitis.targeting RORgammaT not only inhibits Th17 cell development and function but also fundamentally alters thymic-emigrant recognition of self and foreign antigens. PMID: 28009290
  4. RORgamma mediates epithelial-mesenchymal transition of hepatocytes during hepatic fibrosis facilitated by TGFbeta1. PMID: 27791279
  5. Heterozygous deletion of RORgammat gene resulted in aggravated cardiac remodeling, accompanied by reduced capillary density, after MI, suggesting that RORgammat-expressing cells contribute to tissue repair in infarcted myocardium PMID: 28827845
  6. IKKalpha-dependent phosphorylation of S376 stimulated whereas IKKalpha-independent phosphorylation of S484 inhibited RORgammat function in Th17 differentiation. PMID: 28667162
  7. we identified a two-amino-acid substitution in RORgammat (RORgammat(M)) that 'preferentially' disrupted TH17 differentiation but not thymocyte development. Mice expressing RORgammat(M) were resistant to EAE associated with defective TH17 differentiation but maintained normal thymocyte development and normal lymph-node genesis, except for Peyer's patches. PMID: 28846085
  8. secretion of IL-17 by biTregs was abrogated completely in FoxP3(Cre) x RORC(fl/fl) mice. Furthermore, Tregs showed a more activated phenotype after cell-specific inactivation of RORgammat signalling. Finally, and remarkably, biTregs were found to potently suppress anti-inflammatory Th2 immunity in a RORgammat-dependent manner. PMID: 27880975
  9. this paper shows that RORgammat antagonist, A213 suppresses Sjogren's syndrome-like sialadenitis PMID: 27643385
  10. this study reveales a new mechanism through which procyanidin B2 gallates inhibit IFN-gamma and IL-17 production in T cells by down-regulation of T-bet and RORgammat expression PMID: 28088699
  11. The data suggest that RORgt expression in Tregs contributes to an optimal suppressive capacity during gut-specific immune responses, rendering Foxp3-RORgt T cells as an important effector Treg subset in the intestinal system. PMID: 26307665
  12. up-regulated expression in abortion mouse model PMID: 26474535
  13. Rag-RORgammat-reporter and Rag KO mice undergoing ischemia reperfusion injury expressed high protein levels of both IL-22 and GFP (RORgammat) PMID: 26341825
  14. Overexpression of RORgammat Enhances Pulmonary Inflammation after Infection with Mycobacterium Avium. PMID: 26784959
  15. Results reveal differential requirements for ROR-gammat in the maintenance of TH17 cell and group 3 innate lymphoid cell responses in intestinal inflammation. PMID: 26878233
  16. Binding at this non-canonical site induces an unprecedented conformational reorientation of helix 12 in the RORgammat ligand binding domain. PMID: 26640126
  17. injected chlorhexidine gluconate into wild-type, T-bet Tg, GATA-3 Tg, and RORgammat Tg mice and analyzed body weight on day 21 PMID: 26156402
  18. Dysregulated development of IL-17- and IL-21-expressing follicular helper T cells and increased germinal center formation in the absence of RORgammat. PMID: 26499265
  19. BET bromodomains are involved in psoriasis-like inflammation through induction of RORC/IL-17A pathway. PMID: 26149470
  20. High-fat diet - induced type 2 diabetes decreases the number of ileum IL17/RORgammaT CD4 T cells. PMID: 26154056
  21. These results suggest that both RORgammat-overexpressed CD4(+) T cells and reduced Treg cells might contribute to the development of Sjogren's syndrome -like sialadenitis. PMID: 25411202
  22. study reports that microbiota-induced T(regs) express RORgammat and differentiate along a pathway that also leads to T(H)17 cells; in the the absence of RORgammat+ Tregs, TH2-driven defense against helminths is more efficient, whereas TH2-associated pathology is exacerbated PMID: 26160380
  23. study found Rorgamma, and the T(regs) that express it, contribute substantially to regulating colonic T(H)1/T(H)17 inflammation; the marked context-specificity of Rorgamma results in very different outcomes even in closely related cell types PMID: 26272906
  24. mucosal draining lymph nodes express CCR7, which has a role in trafficking of RORgamma innate lymphoid cells PMID: 25575242
  25. RORgammat overexpression in T cells protected against the development of CIA. PMID: 25928901
  26. Data indicate that ablation of retinoic-acid-related orphan receptor (RORC1/RORgamma) in the hematopoietic compartment prevented cancer-driven myelopoiesis, resulting in inhibition of tumor growth and metastasis. PMID: 26267538
  27. We conclude that Foxo1 is a direct antagonist of the RORgammat-Th17 program acting in a T cell-intrinsic manner. PMID: 26170390
  28. IL-23 plus T-cell receptor signalling results in significant upregulation of IL-23 receptor expressed predominantly on CD4(hi)CD8(hi)CD3(+)alphabetaTCR(+) thymocytes, and leads to RORgammat-dependent apoptosis. PMID: 25001511
  29. TF enhances expression of genes for transcription factor RORgammat. The enhanced expression of the RORgt gene corresponds with an increase in the number of RORgammatCD4 Th17 cells and with enhanced IL-17 production. PMID: 25629265
  30. Data indicate that the retinoic acid receptor-related orphan nuclear receptor gammat (RORgammat) inverse agonist TMP778 blocks interleukin-17A-secreting T helper type 17 (Th17) cell differentiation. PMID: 25604624
  31. These results indicate an important role for the immunological milieu in colitis-associated cancer, which is shaped in-part by RORgammat-dependent Th17 lymphocytes that support CRC growth. PMID: 25820779
  32. Sirtuin 1 (SIRT1), a protein deacetylase previously reported to have an antiinflammatory function, in fact promotes autoimmunity by deacetylating RORgammat, the signature transcription factor of Th17 cells. PMID: 25918343
  33. These results demonstrate that estradiol upregulates REA expression and recruits REA via ERalpha to the EREs on the RORgammaT promoter region, thus inhibiting RORgammaT expression and Th17 differentiation. PMID: 25769926
  34. RORgammat-specific transcriptional interactomic inhibition suppresses autoimmunity associated with TH17 cells. PMID: 25527718
  35. The study indicates that RORgamma functions as an important link between the circadian clock and the transcriptional regulation of several metabolic genes. PMID: 25143535
  36. Transcription of RORgammat in developing Th17 cells is regulated by E-proteins. PMID: 24064669
  37. The inhibition of the activation of several metabolic gene promoters by an RORgamma antagonist suggests that antagonists may provide a novel strategy in the management of metabolic diseases, including type 2 diabetes PMID: 24831725
  38. miR-20b suppresses Th17 differentiation and the pathogenesis of experimental autoimmune encephalomyelitis by targeting RORgammat and STAT3. PMID: 24842756
  39. Data indicate that CD5-casein kinase 2 (CK2) signaling is necessary for efficient nuclear localization of orphan nuclear receptor ROR-gammaT (RORgammat). PMID: 24356888
  40. Data suggest that RORgammat is a tractable drug target for the treatment of cutaneous inflammatory disorders. PMID: 24516202
  41. Gata3 plays a generalized role in innate lymphoid cell (ILC) lineage determination and is critical for the development of gut RORgammat(+) ILC3 subsets that maintain mucosal barrier homeostasis. PMID: 24419270
  42. IL-22-producing RORgammat-dependent innate lymphoid cells play a novel protective role in murine acute hepatitis. PMID: 23626860
  43. RORgammat+IL-17+ neutrophils play a critical role in hepatic ischemia-reperfusion injury. PMID: 23362310
  44. Unconventional and double-negative T cells are major RORgammat-expressing effector cells that play a mechanistic role in early ischemia reperfusion injury. PMID: 23740948
  45. RORgammat has a central role in determining the balance between protective and pathogenic regulatory T cells in colorectal cancer. PMID: 23241743
  46. RORgammat-deficient Rag- 2-/- mice developed more severe DSS-induced colitis accompanied with lower expression of REG3b and REG3gamma in the colon. PMID: 23022186
  47. RORgammat-overexpressing mice developed steroid-insensitive neutrophilic inflammation under Th17-biased conditions. Neutrophil chemotaxis-related mediators were elevated in OVA-exposed RORgammat-overexpressing mice. PMID: 23293351
  48. Results demonstrate that the lack of retinoic acid-related orphan receptor gamma expression in mice significantly reduced the peak expression level of Cry1, Bmal1, E4bp4, Rev-Erbalpha and Per2 in a tissue-selective manner without affecting the phase of their rhythmic expression. PMID: 22753030
  49. These results suggest that ROR-gamma-t plays important roles in the development of plasmacytosis and autoantibody production. PMID: 22623033
  50. CD4(+) T cell expression of RORgammat is important in the pathogenesis of acute Graft-versus-host disease. PMID: 22778391

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
Nuclear hormone receptor family, NR1 subfamily
Tissue Specificity
Expressed in immature Vgamma2 gamma-delta T-cells (at protein level). Expressed in the liver. Expressed in the heart. Expressed in the kidney, jejunum, and brown adipose tissue.; [Isoform 1]: Expressed in muscle and the thymus. Expressed in the brain, hea
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*