Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Pcnt

Uniprot No.

P48725

Research Area

Tags & Cell Markers

Alternative Names

Pcnt; Pcnt2; Pericentrin

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

2545-2810aa

Target Protein Sequence

LCAAGLLTSFTNHTVDRTIKDWTSSNEKAVSSLMRTLEELKSELSMPTSFQKKMTAELQVQLMNELLSDNDALTKAVGMATREKAELCRTVSRLEKTLKHHTQKGCVLNRQSKSSLKQDGTDLQSSLRHSDPEWHSQTTSGDTNTCNIKMEKLYLHYLRAESFRKALIYQKKYLLLLIGGFQDSEQETLSMIAHLGVFPSKADKKITMSRPFTKFRTAVRVVIAVLRLRFLVKKWQEVDRKGALVHPKSTRHGHRTSQRQRSPSGP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

37.7 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer，50% glycerol

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Integral component of the filamentous matrix of the centrosome involved in the initial establishment of organized microtubule arrays in both mitosis and meiosis. Plays a role, together with DISC1, in the microtubule network formation. Is an integral component of the pericentriolar material (PCM). May play an important role in preventing premature centrosome splitting during interphase by inhibiting NEK2 kinase activity at the centrosome.

Gene References into Functions

experiments demonstrate a role for Pericentrin in modulating Piezo2 activity and membrane expression in somatosensory neurons PMID: 27345391
Meiotic division is highly error-prone in the absence of Pcnt and disrupted acentriolar microtubule-organizing centers. PMID: 28193732
Pericentrin is a key functional component of the unique acentriolar MTOCs of mouse oocytes, and plays an important role in regulating meiotic spindle assembly and/or stability. PMID: 25266793
The mouse Pcnt(-/-) phenotype was associated with misdirected ventricular septal growth in the heart, decreased proliferative symmetric divisions in brain neural progenitors, and increased misoriented divisions in fibroblasts. PMID: 25220058
Findings suggest distinct functional roles of several Pcnt variants in different ciliated tissues and sensory neurons, like the olfactory epithelium and the retina of the mouse PMID: 22031837
A mutation in the pericentrin gene causes abnormal interneuron migration to the olfactory bulb in mice PMID: 20096683
results confirm that MT1-MMP cleaves pericentrin-2 in humans but not in mice and that mouse models of cancer probably cannot be used to critically examine MT1-MMP functionality PMID: 16251193
Pcnt was shown to be localized to the base of primary cilia in multiple embryonic tissues, in agreement with a recent study demonstrating the involvement of Pcnt in primary cilia formation using cultured mammalian cells. PMID: 16534625
Pericentrin forms complexes with CHD3 and CHD4, but a distinct CHD3-pericentrin complex is required for centrosomal anchoring of pericentrin/gamma-tubulin and for centrosome integrity. PMID: 17626165
pPKCdelta(Thr505) interacts with MTOC-associated proteins pericentrin and gamma-tubulin, and plays a role in meiotic spindle organization in oocytes PMID: 18602096
pericentrin is essential for the assembly of chemosensory cilia of olfactory receptor neurons, but it is not globally required for cilia formation in mammals. PMID: 19470799

Hide All

Subcellular Location

Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.

Tissue Specificity

Expressed in heart and lung (at protein level). Expressed in kidney, thymus, liver, brain, muscle, testis, spleen, lung and heart.

Database Links

KEGG: mmu:18541

STRING: 10090.ENSMUSP00000001179

UniGene: Mm.251794

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-EP017627MO
MSDS	MSDS
Size	US$388
	Order now
Image	Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP017627MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pcnt. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP017627MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pcnt.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Pericentrin (Pcnt), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage