Recombinant Mouse Platelet-derived growth factor subunit A (Pdgfa)

Code CSB-YP017708MO
Abbreviation Recombinant Mouse Pdgfa protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Others
Alternative Names
PDGF-1;Platelet-derived growth factor A chain;Platelet-derived growth factor alpha polypeptide
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
87-211aa
Target Protein Sequence
SIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKKRKRKRLKPT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
16.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal lung alveolar septum formation during embryogenesis, normal development of the gastrointestinal tract, normal development of Leydig cells and spermatogenesis. Required for normal oligodendrocyte development and normal myelination in the spinal cord and cerebellum. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFB.
Gene References into Functions
  1. PDGF-A signaling is involved in myofibroblast proliferation and migration. PMID: 29636361
  2. These studies uncover PI3K/AKT2 as a direct PDGFA target that is activated in adipocyte stem cells. PMID: 27746098
  3. stronger fibrotic effect generated by Platelet-derived growth factor alpha overexpression was mediated by Platelet-derived growth factor receptor alphalpha in cardiac interstitial mesenchymal cells PMID: 27816607
  4. PDGF-AA impairs endothelium-dependent vasodilation and PDGF-AA mediates BMP4-induced adverse effect on endothelial cell function through SMAD1/5- and SMAD4-dependent mechanisms. PMID: 26769046
  5. Both cell proliferation and hair inductive activity in murine DPCs are maintained by the synergistic effect of fibroblast growth factor 2 and platelet-derived growth factor receptor alpha. PMID: 25975959
  6. Primary high invasive Glioma initiating cells SU3 contribute to transformation of adjacent normal host glial cells in local tumor microenvironment possibly via PDGF/PDGFR signaling activation. PMID: 26049020
  7. Platelet-derived growth factor mediates interleukin-13-induced collagen I production in mouse airway fibroblasts. PMID: 25116623
  8. senescent cells have a role in optimal wound healing through secretion of PDGF-AA PMID: 25499914
  9. leading to a PDGF-responsive SRF-driven transcriptional program in the midface PMID: 25453829
  10. Platelet-derived growth factor plays an integral role in mediating TGF-beta1-dependent mesenchymal stem cell stiffening. PMID: 24093435
  11. GPIbalpha blockade reverses production of interleukin (IL)-1alpha by microglia in response to cerebral ischemia in animals with Streptococcus pneumoniae infection. PMID: 24644058
  12. these data uncover an early role of PDGF signaling in primitive endoderm cell survival. PMID: 23733391
  13. PDGFA-long isoform plays a critical role in normal development of the lung, intestine, and vertebral column. PMID: 23938297
  14. study examined lung fibroblasts (LF) to learn whether PDGFRalpha expression distinguished a population of precursor cells with enhanced proliferative and migratory capabilities; PDGF-A and Shh both increased cytokinesis and chemotaxis of LF but through different mechanisms PMID: 23748534
  15. Nuclear localization of FoxO3a, an important regulator of p27(kip1) gene-expression, correlates with diminished proliferation of the PDGFRalpha-expressing LF subpopulation. PMID: 23819440
  16. Pdgf signaling potentiates Wnt2-Wnt7b signaling to promote high levels of Wnt activity in mesenchymal progenitors that is required for proper development of endoderm-derived organs, such as the lung PMID: 22949635
  17. These results suggest that PDGF functions as a positive regulator in the final differentiation phase of tongue muscle cells in mouse embryos. PMID: 22264326
  18. the serum-induced increase in cell surface GLUT4 levels is not due to inhibition of its internalization and is not mediated by insulin, PDGF, IGF-1, or HGF PMID: 21187969
  19. PDGF protects neurons from H2O2-induced cytotoxicity, and that PI-3K/Akt and MAPK pathways are involved in the protective effects; PDGF-BB exerted more potent neuroprotective effects than PDGF-AA PMID: 19998489
  20. PDGF-A/PDGF alpha-receptor signaling required for lung growth and the formation of alveoli but not for early branching of the lung epithelium PMID: 11803579
  21. PDGF signaling through the alpha receptor is an important event downstream of Sry in testis organogenesis and Leydig cell differentiation PMID: 12651897
  22. PDGF system is highly expressed in the epididymis and suggest that PDGF could be involved in the maintenance of morphological structure and functional control of this organ. PMID: 14522834
  23. PDGF controls c-myc expression through a JNK- and AP-1-dependent signaling pathway PMID: 14523011
  24. In vitro cultures supporting the spontaneous generation of functional cardiac myocytes from murine BMCs demonstrated induced expression of PDGF-A and -B. PDGF-AB enhances the generation of BMC-derived cardiac myocytes in mouse hearts. PMID: 14963008
  25. PDGFRalpha and PDGFA are critical regulators for the continued epithelial-mesenchymal interaction during tooth and palate morphogenesis PMID: 15543606
  26. PDGF regulates gene expression through a Src Family Kinase-secific pathway that is distinct from the Ras-MAPK and PI3K pathways, and SFKs signal gene expression by enhancing mRNA stability PMID: 15637050
  27. thrombospondin-1 is not necessary for proliferation but is permissive for vascular smooth muscle cell responses to platelet-derived growth factor PMID: 15890262
  28. the complete PDGF-A/PDGFR-alpha signaling system is present in murine reproductive tissues, but the distribution of the long and short isoforms of PDFG-A differs PMID: 15932761
  29. loss of FSH-R signaling causes an imbalance of PDGF family members predisposing the abnormal ovarian follicular environment for inducing tumorigenesis in aging FORKO mice PMID: 16344272
  30. FGF and PDGF have roles in cell proliferation and migration in osteoblastic cells PMID: 17852407
  31. One mechanism accounting for the PDGF induction of Glut4 translocation is the suppression of the Munc18c negative regulation of Syntaxin 4 function. PMID: 17916632
  32. study identified PDGF-A as a candidate epicardium-derived secreted mitogen PMID: 18297729
  33. During kidney development, PDGFR beta-mediated reactive oxygen species generation and Ca(2+) influx suppress PDGF AA-induced chemotaxis in metanephric mesenchyme. PMID: 19019919
  34. These results imply a central role of NFI-C in the interplay of the two signaling pathways and in regulation of the progression of tissue regeneration. PMID: 19752192

Show More

Hide All

Subcellular Location
Secreted. Note=Released by platelets upon wounding.
Protein Families
PDGF/VEGF growth factor family
Tissue Specificity
Expression primarily localized in papillary regions with presumable expression in tubular cells comprising the loop of Henle. In the renal cortex, a widespread expression seen in the vascular smooth muscle cells and is barely detectable in interstitial ce
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*