Recombinant Mouse Protein Wnt-8a (Wnt8a)

Code CSB-MP734110MO
Abbreviation Recombinant Mouse Wnt8a protein
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Developmental Biology
Alternative Names
Protein Wnt-8d;Stimulated by retinoic acid gene 11 protein
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
20-354aa
Target Protein Sequence
ASAWSVNNFLITRPKAYLTYTASVALGAQIGIEECKFQFAWERWNCPEHAFQFSTHNRLRAATRETSFIHAIRSAAIMYAVTKNCSMGDLENCGCDESQNGKTGGHGWIWGGCSDNVEFGEKISRLFVDSLEKGKDARALVNLHNNRAGRLAVRASTKRTCKCHGISGSCSIQTCWLQLADFRQMGNYLKAKYDRALKIEMDKRQLRAGNRAEGRWALTEAFLPSTEAELIFLEGSPDYCNRNASLSIQGTEGRECLQNARSASRREQRSCGRLCTECGLQVEERRAEAVSSCDCNFQWCCTVKCGQCRRVVSRYYCTRPVGSARPRGRGKDSAW
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
105.7 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-HSA-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ligand for members of the frizzled family of seven transmembrane receptors. Plays a role in embryonic patterning.
Gene References into Functions
  1. Caudal Wnt8a is expressed only early somite stages. It is needed for normal anterior trunk development in the absence of Wnt3a. Wnt8a and Wnt3a cooperate to maintain Fgf8 expression and stop premature Sox2 up-regulation in the axial stem cell niche. PMID: 25809880
  2. Wnt8a expression depends on the presence of Fgf3 indicating a serial regulation between Fgf and Wnt signalling during otic placode induction and specification. PMID: 23041177
  3. demonstrate that both the enlargement of the otic placode and the expansion of the Wnt8a expression domain can be rescued in Spry1/; Spry2/ embryos by reducing the gene dosage of Fgf10 PMID: 21362415
  4. FGF signaling regulates otic placode induction and refinement by controlling both ectodermal target genes and hindbrain Wnt8a. PMID: 20171206
  5. Developmental regulation of this protein is involved in cardiac myogenesis PMID: 12719544
  6. The Wnt8A expression was evaluted in the resultant Tg(CAG-mWnt8A) embryos to identify mWnt8A misexpression. PMID: 16256739

Show More

Hide All

Subcellular Location
Secreted, extracellular space, extracellular matrix. Secreted.
Protein Families
Wnt family
Database Links

KEGG: mmu:20890

STRING: 10090.ENSMUSP00000012426

UniGene: Mm.558

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*