Recombinant Mouse Protransforming growth factor alpha (Tgfa), partial

Code CSB-MP023445MO
Abbreviation Recombinant Mouse Tgfa protein, partial
MSDS
Size $190
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
Tgfa
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
39-88aa
Target Protein Sequence
VVSHFNKCPDSHTQYCFHGTCRFLVQEEKPACVCHSGYVGVRCEHADLLA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.9 kDa
Protein Length
Partial
Tag Info
N-terminal hFc1-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.
Gene References into Functions
  1. Tgfa null mice are equally susceptible to spontaneous osteoarthritis development during aging. PMID: 27457421
  2. Here the authors show that the mammalian rhomboid protease RHBDL4 (also known as Rhbdd1) promotes trafficking of several membrane proteins, including the EGFR ligand TGFalpha, from the endoplasmic reticulum (ER) to the Golgi apparatus, thereby triggering their secretion by extracellular microvesicles. PMID: 27264103
  3. TGF-alpha contributes to the progression of diabetic kidney disease. PMID: 28249836
  4. Perturbed meibomian gland and tarsal plate morphogenesis by excess TGFalpha in eyelid stroma. PMID: 26363126
  5. c-Myc and transforming growth factor alpha enhance the development of hepatic lesions due to mutant beta-catenin in transgenic mice. PMID: 25402175
  6. Reverse transcriptase polymerase chain reaction studies showed that three members, Tgfa, Hbegf,and Nrg1 of the EGF family were expressed in the epithelium cultured with FGF7 + LPA as well as in the epithelium freshly isolated from the rudiments. PMID: 24227310
  7. findings suggest that elevated PHD4 levels disturb the angiogenic balance in osteosarcoma via induction of the TGF-alpha pathway and inhibit tumor growth by reducing the expression of HIF-2alpha PMID: 24048703
  8. Interaction between IRF6 and TGFA genes contribute to the risk of nonsyndromic cleft lip/palate. PMID: 23029012
  9. TGFalpha appears to be an important growth factor regulating the conversion of cartilage to bone during the process of endochondral ossification. PMID: 22575362
  10. These results imply that TGFalpha stimulates proliferation of endometrial stromal cells through multiple mechanisms, including its regulation of Igfbp3 and Mmp3 transcription. PMID: 22639808
  11. ADAM-17 and TGF-alpha are strongly and locally upregulated following adult mice cortical damage. PMID: 21837653
  12. Different mechanisms regulate neurogenesis in neonatal and adult olfactory epithelium; fibroblast growth factor (FGF)2 and TGFalpha may have different roles throughout development. PMID: 21187124
  13. beta-catenin controlled both cell-autonomous and non-cell-autonomous hepatocyte proliferation, through direct transcriptional and complex control of cyclin D1 gene expression and of the expression of a new target gene, Tgfalpha. PMID: 21145869
  14. variable TGF-alpha expression may explain, in part, the genetic susceptibility to chronic kidney disease (CKD) progression. PMID: 21183591
  15. our results suggest that TGFalpha overexpression in mouse urogenital organs alone may not be responsible for tumor formation and epithelial hyperplasia, but is involved in bladder outlet obstruction PMID: 20638776
  16. This may be the first report of the expression of carcinogenesis-related molecules such as EGFR, K-ras, Cox2 and TGFalpha during chronic pancreatitis. PMID: 20660988
  17. EGFR-dependent increases in receptor ligands TGFa and PTGS2 likely drive diet-related tumor promotion PMID: 19903783
  18. TGFalpha has a role in the development of preneoplastic melanocytic lesions in the eye but not the skin PMID: 12394184
  19. TGF-alpha produced primarily in the somatotrophs mediates the stimulatory effects of estrogen on the DNA replication of pituitary cells in a paracrine or autocrine manner PMID: 12560605
  20. TGF-alpha might affect astrocytic hypertrophy without affecting microgliosis not only in the normal condition, but also in the pathological condition. PMID: 12866207
  21. In the fetal mouse, expression of tgf-alpha affects the ability of TCDD to inhibit prostatic bud formation in a region-specific manner. PMID: 14514962
  22. Induction of pulmonary fibrosis by TGF-alpha was independent of inflammation or early activation of TGF-beta. PMID: 14660483
  23. Transient induction of TGF-alpha during early alveologenesis permanently disrupted lung structure and function and caused chronic lung disease. PMID: 15090366
  24. MAGI-3 has a role in efficient trafficking of TGFalpha to the cell surface in polarized epithelial cells. PMID: 15652357
  25. TGF-alpha is not required for mouse renal cyst formation or kidney or liver disease progression PMID: 15774823
  26. role in inducing uteroglobin-related protein 2 expression PMID: 15811345
  27. significant role for stromal TGF-beta signaling in mammary tissue homeostasis and mammary tumor progression via regulation of TGF-alpha signaling pathways. PMID: 15856015
  28. Overexpression of TGFalpha in MT-TGFalpha mice and Menetrier's disease patients elicits ectopic expression in the fundus of Pdx1, consistent with the phenotype of antralization. PMID: 15887112
  29. TGF-alpha inhibits apoptosis in mouse blastocysts through upregulation of survivin expression PMID: 16079309
  30. the production of TGF-alpha by HRCC cells leads to the activation of EGFR on tumor-associated endothelial cells that serve as an essential target for therapy with tyrosine kinase inhibitors PMID: 16820093
  31. Epithelial cell proliferation and apoptosis in mammary glands, from transgenic mice engineered to develop mammary cancer due to expression in mammary epithelia of transforming growth factor alpha (TGF-alpha) or c-myc,was analysed. PMID: 17071603
  32. Contrary to what is observed in mice, Tgfalpha mRNA levels in the SCN of Muridae do not match timing of locomotor activity and are modulated by light PMID: 17289271
  33. unregulated TGFalpha expression in the mammary gland leads to oncogenesis that is dependent on ovarian steroids early in tumorigenesis PMID: 17334393
  34. TGF-alpha-overexpressing mice bore similarities to premature infants born in the saccular phase who develop bronchopulmonary dysplasia, including remodeling of the distal lung septae and arteries PMID: 17468132
  35. Muc1 is an important modulator of TGFalpha-dependent tumor progression PMID: 17638868
  36. Concomitant expression of TGFalpha and Kras(G12D) accelerates the progression of mPanIN lesions to metastatic pancreatic cancer and leads to the development of cystic papillary lesions resembling human intraductal papillary mucinous neoplasms (IPMN). PMID: 17785207
  37. TGFalpha has a novel suppressive function that contributes to decelerating distal lung cell proliferation synergistically with HB-EGF through EGFR in perinatal distal lung development PMID: 18069687
  38. PRL expands the pool of cells susceptible to tumorigenesis, which is then facilitated by PRL and TGF-alpha cross talk PMID: 18156207
  39. Widespread hyperplasia induced by transgenic TGFalpha in ApcMin mice is associated with regional effects on tumorigenesis PMID: 18310091
  40. Expression of imprinted Igf2 and Peg1/Mest genes in postimplantation parthenogenetic mouse embryos treated with transforming growth factor alpha in vitro PMID: 18825967

Show More

Hide All

Subcellular Location
[Transforming growth factor alpha]: Secreted, extracellular space.; [Protransforming growth factor alpha]: Cell membrane; Single-pass type I membrane protein.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*