Recombinant Mouse Signal transducer and transcription activator 6 (Stat6), partial

Code CSB-YP022816MO
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP022816MO
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP022816MO-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP022816MO
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP022816MO
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Stat6; Signal transducer and transcription activator 6
Species
Mus musculus (Mouse)
Expression Region
515-635aa
Target Protein Sequence
WQWFDGVLDLTKRCLRSYWSDRLIIGFISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSSQIENIQPFSAKDLSIRSLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMG
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Carries out a dual signal transduction and activation of transcription. Involved in IL4/interleukin-4- and IL3/interleukin-3-mediated signaling.
Gene References into Functions
  1. Our study demonstrates that STAT6 deficiency dysregulates the macrophage response to inflammatory outbursts by increasing the presence of a population of CD16+ macrophages that seems to contribute to intestinal fibrosis. PMID: 29304229
  2. inhibition of the Stat6 pathway in Tumor-associated macrophages (TAMs) is a vital therapeutic approach to attenuate tumor growth and metastasis by inhibiting TAM-induced protumorigenic and prometastatic activities PMID: 29066614
  3. IL-4/ STAT6 signaling needs to be well adjusted to ensure proper development and function of homing Th2 cells. PMID: 29738764
  4. These results provide the first evidence that STAT6 affects depressive-like behavior through downregulating monoamines, including dopamine and 5-HT in the hippocampus of brain PMID: 29587269
  5. IL-4-STAT6 signaling pathway establishes an alternative polarization-specific epigenenomic signature resulting in dampened macrophage responsiveness to inflammatory stimuli PMID: 29343442
  6. IL-4Delta2 did not compete with IL-4 for IL-4Ralpha binding and did not interfere with the downstream STAT-6 phosphorylation in T cells. PMID: 28917204
  7. Histamine and Stat6 have roles in differentiation of macrophages from CD11b(+) myeloid cells and formation of foam cells PMID: 28600950
  8. IL-4Ralpha deficiency inhibited the activation of STAT6 in the mouse kidneys in two experimental models of renal fibrosis. . In vitro, IL-4 activated STAT6 and stimulated expression of alpha-smooth muscle actin and fibronectin in mouse bone marrow monocytes. PMID: 28739140
  9. a T cell-specific Stat6/Pten axis links cold exposure or ADRB3 stimulation with Foxp3(+) Treg induction and adipose tissue function. PMID: 28877454
  10. these findings show that Stat6 has an oncogenic role in intestinal tumorigenesis by promoting polyp cell proliferation and immunosuppressive mediators, and preventing an active cytotoxic process. PMID: 28654863
  11. STAT6 facilitated atherosclerotic plaque stabilization by promoting the polarization of macrophages to M2 subtype and antagonizing ox-LDL-induced cell apoptosis and lipid deposition in a Wnt-beta-catenin-dependent manner. PMID: 28615615
  12. Colorectal carcinoma cells induce M2 polarization of tumor-associated macrophagess through MFHAS1 induction and subsequent STAT6 and KLF4 activation to promote CRC progression. PMID: 27783989
  13. Our results demonstrate that STAT6 is critical in the early steps of colitis-associated colon cancer (CAC) development for modulating inflammatory responses and controlling cell recruitment and proliferation. Thus, STAT6 may represent a promising target for CAC treatment. PMID: 28385737
  14. Gefitinib effectively inhibits tumor-associated macrophage M2-like polarization both in vitro and in vivo by targeting the STAT6 signaling pathway. PMID: 29022575
  15. these results demonstrate that a STAT6-dependent macrophage phenotype promotes mucosal repair in murine inflammatory bowel disease through activation of the Wnt signaling pathway PMID: 26601901
  16. These data indicate a role for STAT3 in maintaining a steady state in the beta-cell, by modulating its cell cycle and protection from DNA damage. PMID: 27336716
  17. STAT6 phosphorylation (p-STAT6) was significantly increased in TECs from both Grave's disease patients and experimental autoimmune Graves' disease mice. PMID: 27906181
  18. this study shows that sodium benzoate induces the expression of TGF-beta in splenocytes and alleviates experimental allergic encephalomyelitis via the STAT6-TGF-beta-Treg pathway PMID: 27605008
  19. this study shows that wild-type mice develop an eosinophilic Th2 airway disease in response to Alternaria alternata exposure, whereas STAT6-deficient mice exhibit a primarily neutrophilic response PMID: 27815425
  20. this study shows that IL-17A contributes to asthma pathophysiology by increasing the capacity of IL-13 to activate intracellular signaling pathways, such as STAT6 activation PMID: 27417023
  21. RCM-1 reduced IL-13 and STAT6 (signal transducer and activator of transcription 6) signaling and prevented the expression of the STAT6 target genes Spdef and Foxa3, which are key transcriptional regulators of goblet cell differentiation. PMID: 28420758
  22. These studies are the first to demonstrate that gammadelta17 cells express the type I IL-4 receptor and that STAT6 signaling negatively regulates gammadelta17 cells, a cell population that plays a front-line role in mucosal immunity. PMID: 26953325
  23. this study identifies proteins in B cells that are regulated by IL-4 in a STAT6-dependent manner, which may contribute to germinal center formation and IgE switching in type 2 immunity PMID: 28348271
  24. STAT6 mediates the CT-induced TIM4 expression in DCs. In conclusion, p300 and STAT6 mediate the microbial product CT-induced TIM4 expression in DCs. PMID: 26899911
  25. These data demonstrate that dysregulated IL-25 expression contributes to lipid accumulation, whereas exogenous IL-25 protects against hepatic steatosis through IL-13 activation of STAT6. PMID: 26423151
  26. Grail interacts with Stat6 and targets it for ubiquitination and degradation in Th2 cells. PMID: 25145352
  27. The lack of STAT6 did not affect the ability of macrophages to change cytokine production reciprocally or to rescue mice from lethal endotoxemia. PMID: 26048978
  28. both in vivo and in vitro experiments demonstrate that the transcription factors STAT6 and KLF4 implement IL-4-induced M2 polarization via the dual catalytic activities of MCPIP. PMID: 25934862
  29. Th2 immunity mediated by STAT6 appears to play a protective role in a murine model of prurigo PMID: 25862819
  30. Data suggest that transcription factor STAT6 regulates the recruitment of eosinophils to the lung during the development of allergic asthma. PMID: 25681342
  31. the cross talk between HDAC4 and STAT6 is an important regulatory mechanism of Arg1 transcription in dendritic cells PMID: 25332236
  32. TSLP induces mast cell development and aggravates allergic reactions through the activation of MDM2 and STAT6. PMID: 24751726
  33. These data show that IL-4 and IL-13 decrease kinin receptors in a STAT6-dependent mechanism, which can be one important mechanism by which these cytokines exert their anti-inflammatory effects and impair bone resorption PMID: 23351078
  34. T-cell-derived extrafollicular IL-4/IL-13 and signal transducer and activator of transcription 6-regulated genes in B cells play a critical role for orchestration of the GC response in type 2 immunity. PMID: 24777733
  35. the Stat6VT mouse may be a useful system in which to further investigate pathogenesis of and treatment strategies for blepharitis and other ocular diseases that develop in association with AD. PMID: 24845637
  36. Stat6 positively regulates a large number of lysosomal genes in an IL-4-dependent manner. PMID: 24314139
  37. results describe a new function of HDL, namely its ability to directly enrich macrophages in markers of the M2, anti-inflammatory, state in a process requiring STAT6 PMID: 23991225
  38. Trichinella spiralis 53-kDa protein (rTsP53) alternatively activates peritoneal macrophages via STAT6 but not via IL-4Ralpha in vitro. PMID: 24534206
  39. In vivo, IL-4-activated STAT6 inhibits nTregs and allows for the propagation of Th2-driven lung inflammation. PMID: 23825312
  40. Our data reveal a complex interaction between STAT6 and PPARgamma in the regulation of liver and adipose tissue lipid depot distribution and design STAT6 as a novel link between inflammatory cell metabolism and adipocyte and hepatocyte function. PMID: 23917405
  41. STAT6 plays an important role for the granuloma formation and liver fibrosis. PMID: 22164377
  42. Th2-like response induced via STAT6-mediated signaling pathway mediates susceptibility to larval stage of T. canis PMID: 23509764
  43. STAT6 signaling negatively regulates IL-17A-mediated neutrophil infiltration into the airway. PMID: 23392574
  44. SWAP-70 controls IgE production through regulation of the antagonistic STAT6 and BCL6 occupancy of the germline IgE promoter PMID: 23589612
  45. STAT6 deficiency promotes autoimmune disease and atopy on a susceptible genetic background. PMID: 22867713
  46. STAT6 is implicated in the pathogenesis of colitis in vivo and has important roles in epithelial barrier function and regulating T helper (Th)2 cell type-inducing cytokine production. PMID: 23303670
  47. The data showed that STAT6 regulated Alternaria-induced lung natrual-helper-cell proliferation and expression of amphiregulin. PMID: 22865552
  48. IL-4 induction of IFN-gamma was explained by its ability to induce Eomesodermin and T-bet transcription factors whose expression was further increased by CD3/CD28. PMID: 22078635
  49. STAT6 is required for the induction of IRF4, which promotes Th9 development PMID: 22180613
  50. These studies suggest STAT6VT mice exhibitabnormal barrier function and provide a novel model systemto explore the role of systemic Th2 cytokine overexpressionon barrier function. PMID: 21959772

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus. Note=Translocated into the nucleus in response to phosphorylation.
Protein Families
Transcription factor STAT family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1