Home
Protein
Recombinant Proteins
Recombinant Mouse T-cell surface glycoprotein CD5 (Cd5), partial

Recombinant Mouse T-cell surface glycoprotein CD5 (Cd5), partial

Code	CSB-MP004942MO
Abbreviation	Recombinant Mouse Cd5 protein, partial
MSDS	MSDS Datasheet
Size	$138
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Target Names

Cd5

Uniprot No.

P13379

Research Area

Immunology

Alternative Names

Lymphocyte antigen 1

Species

Mus musculus (Mouse)

Source

Mammalian cell

Expression Region

24-371aa

Target Protein Sequence

QSGRGGLDIQVMLSGSNSKCQGQVEIQMENKWKTVCSSSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTSSQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSWGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTPAPAELRDPRPLPIRWEAPNGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWEALCDSSAARGRGRWEELCREQQCGDLISFHTVDADKTSPGFLCAQEKLSQCYHLQKKKHCNKRVFVTCQDPNP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

39.3 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

May act as a receptor in regulating T-cell proliferation.

Gene References into Functions

The natural substrate for the cell surface sialidase was identified as clustered differentiation 5 (CD5) by PNA-blot analysis of anti-CD5 immunoprecipitate. PMID: 29897583
FasL expression in splenic CD5(+)CD1d(hi) B cells was decreased compared to the control group after TLR4 ligation. PMID: 28505514
CD5-CK2 signaling axis regulates positive selection by modulating activation of ERK and promoting survival independent of proximal TCR signals PMID: 28030587
the reduction in the positive selection conferred by CD5 overexpression was unaffected by SHP-1 deficiency. PMID: 27221212
In mice lacking functional KDELR1, surviving naive T cells expressed significantly higher levels of CD5, a surrogate marker of TCR self-reactivity. PMID: 26489882
In mouse tumor models, CD5(+) but not CD5(-) B cells promoted tumor growth. The results demonstrate a critical role of CD5(+) B cells in promoting cancer. PMID: 27096320
CD5 and CD72 play a critical role in maintaining regulatory T and B cell homeostasis PMID: 24950378
CD5 promoted Treg cell induction in response to self and tolerizing antigens by blocking mTOR activation. PMID: 25786177
Data indicate that CD5-casein kinase 2 (CK2) signaling is necessary for efficient nuclear localization of orphan nuclear receptor ROR-gammaT (RORgammat). PMID: 24356888
Although the percentage of CD1d(hi)CD5+ subset in splenic B cells does not change significantly, percent IL-10-expressing cells among total splenic B cells or the CD1dhiCD5+ population significantly increases 3-7 days after rCRT/39-272 administration PMID: 23523122
Different CD5 expression levels influence the proliferation dynamics of activated naive CD4+ T cells while leaving the conversion rate of those cells into memory cells unaffected. PMID: 23100516
CD5 glycoprotein-mediated T cell inhibition dependent on inhibitory phosphorylation of Fyn kinase PMID: 21757751
Delayed tumor growth in CD5-deficient mice is associated with enhanced activation of tumor-infiltrating lymphocytes due to an upregulated T cell response to T cell receptor (TCR) stimulation. PMID: 21622855
A conserved enhancer element differentially regulates developmental expression of CD5 in B and T cells. PMID: 21076064
Absence of CD5 dramatically reduces progression of pulmonary inflammatory lesions in SHP-1 protein-tyrosine phosphatase-deficient 'viable motheaten' mice. PMID: 11908943
CD5, an important regulator of lymphocyte selection and immune tolerance. Review. PMID: 12403363
CD5 is rapidly recruited at the immunological synapse (IS) and lowers the T cell response elicited by antigen presentation by targeting downstream signaling events without affecting IS formation. PMID: 12707340
The mechanism that mediates this dynamic antigen-specific T cell unresponsiveness differs from previously described forms of tolerance in that it requires that DCs induce CD5 expression on activated T cells PMID: 15189735
a direct role for CD5-CK2 pathway in T cell activation and persistence of effector T cells in neuroinflammatory disease PMID: 17142752
Ly-1 antibody reactive Embryonic stem cells functions to control the stability of nucleolin protein, which in turn is essential for maintaining their self-renewal PMID: 19489080
Data provide new evidence supporting a potential role of CD5 in thymocyte survival, through a mechanism that may involve the phosphorylation of Akt. PMID: 19609976
Reduced numbers of splenic FasL+ CD5+ B cells correlated with increasing arthritis severity and decreased T-cell death in a T-cell receptor transgenic mouse model of collagen-induced arthritis. PMID: 19706160