Recombinant Mouse Thrombopoietin receptor (Mpl)

Code CSB-YP600093MO
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP600093MO
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP600093MO-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP600093MO
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP600093MO
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Mpl; Tpor; Thrombopoietin receptor; TPO-R; Myeloproliferative leukemia protein; Proto-oncogene c-Mpl; CD antigen CD110
Species
Mus musculus (Mouse)
Expression Region
26-482
Target Protein Sequence
QDVFLLALGTEPLNCFSQTFEDLTCFWDEEEAAPSGTYQLLYAYRGEKPRACPLYSQSVP TFGTRYVCQFPAQDEVRLFFPLHLWVKNVSLNQTLIQRVLFVDSVGLPAPPRVIKARGGS QPGELQIHWEAPAPEISDFLRHELRYGPTDSSNATAPSVIQLLSTETCCPTLWMPNPVPV LDQPPCVHPTASQPHGPAPFLTVKGGSCLVSGLQAGKSYWLQLRSQPDGVSLRGSWGPWS FPVTVDLPGDAVTIGLQCFTLDLKMVTCQWQQQDRTSSQGFFRHSRTRCCPTDRDPTWEK CEEEEPRPGSQPALVSRCHFKSRNDSVIHILVEVTTAQGAVHSYLGSPFWIHQAVLLPTP SLHWREVSSGRLELEWQHQSSWAAQETCYQLRYTGEGREDWKVLEPSLGARGGTLELRPR ARYSLQLRARLNGPTYQGPWSAWSPPARVSTGSETAW
Protein Length
Extracellular domain
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for thrombopoietin that acts as a primary regulator of megakaryopoiesis and platelet production. May represent a regulatory molecule specific for TPO-R-dependent immune responses.; Acts as an inhibitor of thrombopoietin signaling by promoting protein down-regulation of full-length isoform Mpl-fl.
Gene References into Functions
  1. these results demonstrate that MPL P106L is a receptor with an incomplete defect in trafficking. PMID: 28034873
  2. C-Mpl is expressed on osteoblasts and osteoclasts and is important in regulating skeletal homeostasis. PMID: 26375403
  3. CALR mutants are sufficient to induce thrombocytosis through MPL activation. PMID: 26608331
  4. Thrombopoietin receptor activation by myeloproliferative neoplasm associated calreticulin mutants. PMID: 26668133
  5. The interaction between Mpl and Atp5d was confirmed by the yeast two-hybrid system, mammalian two-hybrid assay, pull-down experiment, and co-immunoprecipitation study in vivo and in vitro. PMID: 24615392
  6. Mouse prenatal platelet-forming lineages share a core transcriptional program but divergent dependence on MPL. PMID: 25995324
  7. MERIT40 deficiency triggers hypersensitivity to Tpo stimulation and the stem cell phenotypes are abrogated on a background null for the Tpo receptor Mpl. PMID: 25636339
  8. OTT1 regulates the alternative splicing of Mpl-TR, a truncated isoform of c-Mpl, which modulates Thrombopoietin-mediated signaling. PMID: 25468569
  9. These studies show the importance of the c-Mpl membrane-distal cytokine receptor homology module to thrombopoietin-binding and suggest that mutations within this CRM that perturb TPO binding could give rise to Congenital Amegakaryocytic Thrombocytopenia. PMID: 24438083
  10. Mpl expression on megakaryocytes and platelets is essential to prevent megakaryocytosis and myeloproliferation. PMID: 24711413
  11. These experiments define a novel VEGF-miR-1-Mpl-P-selectin effector pathway in lung Th2 inflammation and herald the utility of miR-1 and Mpl as potential therapeutic targets for asthma. PMID: 24043765
  12. Gene-corrected Mpl(-/-) cells had increased long-term repopulating potential, with a marked increase in lineage(-)Sca1(+)cKit(+) cells and early progenitor populations in reconstituted mice. PMID: 21289307
  13. Data indicate that Mpl is an active player during the first steps of definitive hematopoiesis establishment through direct regulation of the expression of transcription factors or genes important for the self-renewal, proliferation and apoptosis of HSCs. PMID: 20711984
  14. Data locate Mpl expression to neurons at different subdivisions of the spinal cord, rhombencephalon, midbrain and prosencephalon; besides neuronal cells Mpl protein is also expressed in Purkinje cells of the adult cerebellum. PMID: 20667107
  15. study describes a link between Mpl receptor signaling and IKK and NF-kappaB activities in megakaryocytes PMID: 11967992
  16. mpl-II isoform cloning, base sequence, and amino acid sequence - lacks a 60 amino acid region required for surface expression of the protein PMID: 11997107
  17. Thrombopoietin mediates cell proliferation in cells expressing high levels of Mpl but only mediates survival without proliferation in cells expressing low levels of the receptor. PMID: 12006617
  18. A 2-kb c-mpl promoter fragment is sufficient to direct expression to the megakaryocytic lineage and sites of embryonic hematopoiesis in transgenic mice. PMID: 12130527
  19. receptor motifs involved in TPO-induced internalization of Mpl are identified; results suggest that Mpl translocation may be necessary for normal cellular proliferation and that a pool of intracellular Mpl can be rapidly recycled to the cell surface PMID: 12623841
  20. c-Mpl(-/-) Kit(Wv/Wv) mice reveal nonredundant and synergistic effects of Tpo and steel factor on primitive hematopoietic cells. PMID: 15138166
  21. c-Mpl truncated isoform with an essential C-terminal peptide is required for a proteolytic process PMID: 15210714
  22. mpl-tpo signaling pathways are negatively modulated by lnk PMID: 15337790
  23. studies suggest that c-Mpl does not control HSC numbers, as had been previously argued, but rather facilitates the early expansion of differentiating clones. PMID: 17347409
  24. Dual role of Mpl in the generation and expansion of hematopoietic stem cells during establishment of definitive hematopoiesis. PMID: 17634189
  25. Down-regulation of Mpl marks the transition to lymphoid-primed multipotent progenitors with gradual loss of granulocyte-monocyte potential PMID: 18218856
  26. c-Myb/p300 transcriptional regulatory complex has an indispensable role in megakaryocyte development and suppresses thrombocytopenia in Mpl-/- mice PMID: 18684867
  27. AML1 can regulate the c-mpl promoter both positively and negatively by changing the binding partner according to cell types PMID: 18687690
  28. impaired TPO(thrombopoietin) homeostasis in the Mpl transgene-rescued mice produces elevated plasma TPO levels, which serves as an unchecked stimulus to drive the observed excessive megakaryocytopoiesis PMID: 18796624
  29. the severe reduction of Mpl protein in platelets in Mpl-transgenic Mpl(-/-) mice shifts the equilibrium of this feedback loop, resulting in markedly elevated levels of megakaryocytes and platelets at steady state PMID: 18845793
  30. Thrombocytopenia in HLB219 mice is caused by a recessive mutation in Mpl that abrogates mitogen-activated protein kinase-extracellular signal regulated kinase and janus kinase-signal transducers and activators of transcription signaling. PMID: 19059699

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Golgi apparatus. Cell surface.
Protein Families
Type I cytokine receptor family, Type 1 subfamily
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1