Recombinant Mouse Transcription factor SOX-2 (Sox2)

Code CSB-MP022426MO
Abbreviation Recombinant Mouse Sox2 protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
Sox2;Sox-2
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
1-319aa
Target Protein Sequence
MYNMMETELKPPGPQQASGGGGGGGNATAAATGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGGGLNQRMDSYAHMNGWSNGSYSMMQEQLGYPQHPGLNAHGAAQMQPMHRYVVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMAQHYQSGPVPGTAKYGTLPLSHM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
63.8 kDa
Protein Length
Full Length
Tag Info
C-terminal mFc2a-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcription factor that forms a trimeric complex with POU5F1 (OCT3/4) on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Binds to the proximal enhancer region of NANOG. Critical for early embryogenesis and for embryonic stem cell pluripotency. Downstream SRRT target that mediates the promotion of neural stem cell self-renewal. Keeps neural cells undifferentiated by counteracting the activity of proneural proteins and suppresses neuronal differentiation. May function as a switch in neuronal development.
Gene References into Functions
  1. Results indicate that Sox2 expression is regulated by Npnt during tooth development. PMID: 28345658
  2. SOX2 expression in the embryonic brain and lungs.Wdr5 and Tcf3 are binding partners of Sox2. PMID: 29383478
  3. These results suggest that colitis promotes rapid enteric neurogenesis in adult mice and humans through differentiation of Sox2- and PLP1-expressing cells, which represent enteric glia and/or neural progenitors PMID: 28566702
  4. Results provide evidence that Sox2 expression is regulated by the long non-coding RNA Sox2ot in an allele-specific manner. PMID: 29321583
  5. Here we describe an optimized DamID method coupled with next-generation sequencing (DamID-seq) in mouse cells and demonstrate the identification of the binding sites of two TFs, POU5F1 (also known as OCT4) and SOX2, in as few as 1000 embryonic stem cells (ESCs) and neural stem cells (NSCs), respectively. PMID: 29572359
  6. Results show that Sox2 is necessary for the time course of astrocytic maturation in early postnatal retinal development, as well as for the establishment and/or maintenance of astrocytic morphology in adulthood, evidenced by the regional loss of GFAP expression and aberrant sprouting into the inner retina after its removal. PMID: 29178409
  7. SOX2 regulates proliferation through conserved mechanisms and target genes in both germ layers examined. Together, these findings demonstrate how SOX2 simultaneously regulates cell-type-specific, as well as core transcriptional programs in neural and endodermal stem cells. PMID: 29432416
  8. Nup153 and Sox2 bind and co-regulate hundreds of genes. PMID: 28919367
  9. late neuronal development depends directly on Sox2 for differentiation and on the survival of hair cells, possibly derived from common neurosensory precursors. PMID: 27917898
  10. These observations support a role for YY1 meditating and/or regulating the interaction of OCT4 and SOX2 at a posttranscriptional level. PMID: 28682643
  11. The results revealed that the synthesized complex decoy can concomitantly target Sox2 and Oct4, which subsequently represses the stemness properties of mESCs compared to controls through decreasing cell viability, arresting cell cycle in G0 /G1 phases, inducing apoptosis, and modulating differentiation in mESCs despite the presence of 2i/LIF in cell culture. PMID: 28833847
  12. Sox2 activity is crucial for the induction of the neural progenitor gene Hes5 and for subsequent differentiation of the neuronal lineage. PMID: 29352015
  13. Deletion of Sox2 specifically in Sox2(+) cells during incisor renewal revealed cellular plasticity that leads to the relatively rapid restoration of a Sox2-expressing cell population. PMID: 29180573
  14. Tip110 deletion impaired embryonic and stem cell development involving downregulation of stem cell factors Nanog, Oct4, and Sox2. PMID: 28436127
  15. Spermatogonial stem cells and progenitors are refractory to reprogramming to pluripotency by the transcription factors Oct3/4, c-Myc, Sox2 and Klf4. PMID: 28052023
  16. By inhibiting NFATc2 or calcineurin, induced pluripotent stem cells could be established without exogenous Sox2. PMID: 28100021
  17. Folate receptor alpha upregulates Oct4, Sox2 and Klf4 and downregulates miR-138 and miR-let-7 in cranial neural crest cells. PMID: 27300003
  18. Tbx6 and Sox2 co-expression marks a new transient progenitor state of the neuromesoderm lineage. Tbx6 and Sox2 co-expression marks neuromesoderm progenitors in the tail bud. PMID: 29084802
  19. Stem cell and mesenchymal markers, including sex-determining region Y-box 2 (Sox2), are upregulated in aortic ECs of fat-fed ApoE(-/-) mice, which suggests that endothelial-mesenchymal transitions (EndMTs) contribute to atherosclerotic lesion calcification PMID: 27615595
  20. miR-145 modulation of Sox2-Lin28/let-7 network is crucial for neurogenesis progression. PMID: 26849971
  21. widespread destruction of airway and alveolar epithelial cells following severe influenza infection triggers a wound-healing response that initiates in the airways with the proliferation of rare airway-resident SOX2+ Lin- progenitor cells. These cells then give rise to nascent KRT5+ cells in remodeled airways and populate the damaged alveolar parenchyma. PMID: 27773701
  22. The data identify Sox2 as a context-dependent tumor suppressor protein that is dispensable for normal tissue regeneration, but restrains stomach adenoma formation through modulation of Wnt-responsive and intestinal genes. PMID: 27498859
  23. Chd7 is a key regulator of oligodendrocyte precursor cell activation, in which it cooperates with Sox2. PMID: 28931573
  24. CRISPR/Cas9-assisted gene swap provides strong evidence that SOX2 and SOX3 proteins are functionally equivalent in developing brain and testes. PMID: 28515211
  25. Sox2 is required to specify prosensory competence, but subsequent down-regulation of Sox2 must occur to allow Atoh1 expression, most likely through a direct interaction with the Atoh1 promoter. PMID: 27203669
  26. These findings identify Sox2 as a physiological regulator of Schwann cell myelination in vivo and its potential to play a role in disorders of myelination in the peripheral nervous system. PMID: 28743796
  27. Sox2 plays an essential role in melanocyte transformation and melanoma growth. PMID: 28368402
  28. The lack of a tumorigenic role of Sox2 in melanoma might reflect a distinct stem cell program active in neural crest stem cells and during melanoma formation. PMID: 28368416
  29. T, cooperatively with WNT signaling, controls the progenitor state and the switch toward the mesodermal fate. Sox2 acts antagonistically and promotes neural development. PMID: 28826820
  30. Of the 28 proteins, only arginine methyltransferase 7 (PRMT7) changed substantially during mouse embryogenesis and promoted the conversion of mouse fibroblasts into iPSCs. Specifically, PRMT7 replaced SOX2 in a factor-substitution assay, yielding iPSCs PMID: 27225728
  31. this study shows that Sox2 is expressed in activated B cells, but almost exclusively in those that have undergone IgH class switch recombination, enforced expression of Sox2 in splenic B cells severely inhibits AID expression and IgH class switch recombination, and that deletion of Sox2 increases the frequency of IgH:c-Myc translocations PMID: 28188246
  32. Uncovering a Pitx2-Sox2-Lef-1 transcriptional mechanism that regulates dental epithelial stem cells homeostasis and dental development. PMID: 27660324
  33. SOX2 has two independent roles during pituitary morphogenesis. PMID: 27226320
  34. PARP-1 stabilizes Sox2 binding to nucleosomes at suboptimal sites through cooperative interactions on DNA to regulate Sox2 pioneer activity at intractable genomic loci. PMID: 28212747
  35. Maintenance of pluripotency is regulated by a network of transcription factors coordinated by Oct4, Sox2, and Nanog; Trim24 significantly improved efficiency of cellular reprogramming, demonstrating its direct functionality in establishing pluripotency. PMID: 27773674
  36. the level of Cdk kinase activity directly regulates Sox2 to tip the balance between self-renewal and differentiation in neural stem cells. PMID: 28584195
  37. Sox2 was initially expressed in the proneurosensory cells in the otocyst (E10.5). By E12.75 it was downregulated in the developing primary auditory neurons. Sox2 expression transiently increased in the neurons around birth. Sox2 continued to be expressed in spiral ganglion glial cells. PMID: 28118374
  38. Model highlights the essential role of SOX2 in commanding the squamous cell fate from different cells of origin and represents an invaluable tool for developing better intervention strategies. PMID: 27728803
  39. research reveals the molecular basis of the function of Sox2 in pluripotent stem cells and sheds light on its evolutionary origins PMID: 27582319
  40. These data suggest that Pax6 and Sox2 have counteracting roles in regulating neurogenesis. PMID: 27171428
  41. In mouse model of acute uterine injury, Nanog homebox (NANOG) expression reached a peak at 6 h, while sex-determining region Y-box2 (SOX2) and octamer-binding protein 4 (OCT4) peaked later at 12 h after lipopolysaccharide (LPS) treatment. PMID: 28253866
  42. In adult hippocampal neuronal precursor cells, RIT1 controls an Akt-dependent signaling cascade, resulting in the stabilization and transcriptional activation of phosphorylated Sox2. This study supports a role for RIT1 in relaying niche-derived signals to neural/stem progenitor cells to control transcription of genes involved in self-renewal and differentiation PMID: 28007959
  43. bookmarked SOX2 target genes are not differently regulated than non-bookmarked target genes. PMID: 28166426
  44. Data show that expression of the Oct-4, Sox2, Klf4, and c-Myc (OSKM) reprogramming factors induces Cyclin D1 expression, and the increased Cyclin D1 expression during reprogramming promotes continuing embryonic fibroblasts (MEFs) proliferation. PMID: 27790870
  45. On the other hand, cleft formation and branching morphogenesis was suppressed by knockdown of Brachyury gene, suggesting that Brachyury plays a central role in regulating cell growth and cleft formation in early-stage embryonic mouse salivary gland development PMID: 27369076
  46. These data reveal that the degradation of Wnt signaling caused by the knockdown of Sox2 results in a lack of cell migration during tooth development. PMID: 26846112
  47. To our knowledge, this is the first report on lineage reprogramming of TILs using protein stem cell transcription factors delivered directly to the nucleus. PMID: 27084449
  48. Study provides evidence that Sox2 expression is required for the late stages of progenitor cell differentiation to hair cells and stimulates Atoh1 expression through a concentration dependent molecular interaction with the 3' enhancer of Atoh1. PMID: 26988140
  49. Data show that the reprogramming factors OCT4, SOX2, KLF4, and MYC (OSKM) drive cells along two distinct and parallel pathways, one pluripotent and one endodermal. PMID: 26947975
  50. SOX2 is a regulatory factor of Prop1 expression PMID: 26640231

Show More

Hide All

Subcellular Location
Nucleus.
Tissue Specificity
Expressed in the cochlea (at protein level). Expressed in the brain and retina. A very low level of expression is seen in the stomach and lung. Expressed in the kidney.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*