Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Tead4

Uniprot No.

Q62296

Research Area

Cardiovascular

Alternative Names

Tead4; Tcf13r1; Tef3; Tefr1; Transcriptional enhancer factor TEF-3; ETF-related factor 2; ETFR-2; TEA domain family member 4; TEAD-4; TEF-1-related factor 1; TEF-1-related factor FR-19; RTEF-1

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

210-427aa

Target Protein Sequence

RSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

33.0 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (EMT) induction. Binds specifically and non-cooperatively to the Sph and GT-IIC 'enhansons' (5'-GTGGAATGT-3') and activates transcription. Binds to the M-CAT motif. Might play a role in the embryonic development of skeletal muscle.

Gene References into Functions

TEAD4 mediated the interaction between YAP1 and c-JUN. YAP1 and the YAP1-TEADs complex have roles in regulating osteoclastogenesis and related gene expression. PMID: 29432919
Based on the similarity to a related family member, and in vitro transcription/translation product(s), the authors propose that translation initiates from a non-AUG (AUA or AUU) start codon. PMID: 8920920
AP-1- and TEAD4-associated cis-regulatory elements form hubs for multiple signalling-responsive transcription factors and define the cistrome that regulates vascular and hematopoietic development by extrinsic signals. PMID: 27802171
Dual-luciferase reporter gene analysis showed that RTEF-1 is a direct target of mir-125a-5p, which regulates angiogenesis by repressing RTEF-1 expression and modulating eNOS and VEGF expression. PMID: 25059272
TEAD4 establishes the energy homeostasis essential for blastocoel formation. PMID: 23903192
These results show that RTEF-1-stimulated IGFBP-1 expression may be central to the mechanism by which RTEF-1 attenuates blood glucose levels. PMID: 22843786
Vgll1 interacts with TEAD4 in a manner similar to the transcription coactivators, as well as oncogenes YAP and TAZ, despite having a varied primary sequence. Vgll1 has the potential to promote cancer progression. PMID: 22632831
endothelial-specific RTEF-1 overexpressing mice had enhanced angiogenic sprouting and vascular structure remodeling, resulting in the formation of a denser and more highly interconnected superficial capillary plexus PMID: 22652601
Data suggest that altered subcellular localization of TEAD4 in blastomeres dictates first mammalian cell fate specification. PMID: 22529382
TEAD factors directly induce Myogenin, CDKN1A and Caveolin 3 expression to promote myoblast differentiation. PMID: 21701496
Gata3 and Cdx2 can act in parallel pathways downstream of Tead4 to induce the expression of common and independent targets in the trophoblast lineage, whereas Oct4 is required for continued repression of trophoblast fate in the embryonic lineage PMID: 20081188
Novel RTEF-1 transcripts are present within human ocular vascular endothelial cells and mouse neural retina during normal and retinopathy of prematurity development, and alternatively spliced products are produced under hyperoxic and hypoxic conditions PMID: 17652751
RTEF-1 regulated smooth muscle alpha-actin transcription in myofibroblasts, but not in differentiated smooth muscle PMID: 17823374
Tead4 is the earliest gene shown to be uniquely required for specification of the trophectoderm lineage PMID: 17913785
Tead4 has a distinct role from Tead1 and Tead2 in trophectoderm specification of pre-implantation embryos; it is an early transcription factor required for specification and development of the trophectoderm lineage, which includes expression of Cdx2. PMID: 18083014

Hide All

Subcellular Location

Nucleus.

Tissue Specificity

Preferentially expressed in lung and in skeletal muscle.

Database Links

KEGG: mmu:21679

STRING: 10090.ENSMUSP00000006311

UniGene: Mm.14774

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-EP737076MO2b1
MSDS	MSDS
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Transcriptional enhancer factor TEF-3 (Tead4), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage