Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Tmprss4; Cap2; Transmembrane protease serine 4; EC 3.4.21.-; Channel-activating protease 2; mCAP2
Species
Mus musculus (Mouse)
Expression Region
52-435aa
Target Protein Sequence
KVILDKYYFICGSPLTFIQRGQLCDGHLDCASGEDEEHCVKDFPEKPGVAVRLSKDRSTLQVLDAATGTWASVCFDNFTEALAKTACRQMGYDSQPAFRAVEIRPDQNLPVAQVTGNSQELQVQNGSRSCLSGSLVSLRCLDCGKSLKTPRVVGGVEAPVDSWPWQVSIQYNKQHVCGGSILDPHWILTAAHCFRKYLDVSSWKVRAGSNILGNSPSLPVAKIFIAEPNPLYPKEKDIALVKLQMPLTFSGSVRPICLPFSDEVLVPATPVWVIGWGFTEENGGKMSDMLLQASVQVIDSTRCNAEDAYEGEVTAEMLCAGTPQGGKDTCQGDSGGPLMYHSDKWQVVGIVSWGHGCGGPSTPGVYTKVTAYLNWIYNVRKSEM
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Mouse Tmprss4 was expressed with the amino acid range of 52-435. The theoretical molecular weight of the Tmprss4 protein is 57.8 kDa. This Tmprss4 recombinant protein is manufactured in e.coli. The N-terminal 6xHis-SUMO tag was fused into the coding gene segment of Tmprss4, making it easier to detect and purify the Tmprss4 recombinant protein in the later stages of expression and purification.
Mouse transmembrane protease serine 4 (Tmprss4) serves as a key enzyme with its main function centered on proteolytic cleavage of substrates. Its role in regulating protein activation and processing makes Tmprss4 crucial in cellular signaling and homeostasis. Investigating Tmprss4 spans various research areas, contributing to the understanding of cellular dynamics and presenting opportunities for developing targeted interventions, particularly in cancer-related signaling pathways. In the field of cell biology and molecular research, studying Tmprss4 provides insights into protease-mediated cellular processes and signal transduction. Tmprss4's association with cancer progression implicates it in oncology research, offering potential as a therapeutic target.
