Recombinant Mouse Tryptophan 2,3-dioxygenase(Tdo2)

Code CSB-YP023351MO
Product Type Recombinant Protein
Size US$2474
Uniprot No. P48776
Relevance Incorporates oxygen into the indole moiety of tryptophan. Has a broad specificity towards tryptamine and derivatives including D- and L-tryptophan, 5-hydroxytryptophan and serotonin .
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Tryptamin 2,3-dioxygenase
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSGCPFAGNSVGYTLKNVSMEDNEEDRAQTGVNRASKGGLIYGNYLQLEKILNAQELQSEVKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVIARMHRVVVIFKLLVQQFSVLETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQSLRVPYNRKHYRDNFGGDYNELLLKSEQEQTLLQLVEAWLERTPGLEPNGFNFWGKFEKNILKGLEEEFLRIQAKTDSEEKEEQMAEFRKQKEVLLCLFDEKRHDYLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDTLMTKWRYNHVCMVHRMLGTKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLVPRHWVPKMNPIIHKFLYTAEYSDSSYFSSDESD
Research Area Others
Source Yeast
Gene Names Tdo2
Protein Names Recommended name: Tryptophan 2,3-dioxygenase Short name= TDO EC= 1.13.11.11 Alternative name(s): Tryptamin 2,3-dioxygenase Tryptophan oxygenase Short name= TO Short name= TRPO Tryptophan pyrrolase Tryptophan
Expression Region 1-406aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 49.8kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Heme-dependent dioxygenase that catalyzes the oxidative cleavage of the L-tryptophan (L-Trp) pyrrole ring and converts L-tryptophan to N-formyl-L-kynurenine. Catalyzes the oxidative cleavage of the indole moiety.
Protein Families Tryptophan 2,3-dioxygenase family
Database Links

KEGG: mmu:56720

STRING: 10090.ENSMUSP00000029645

UniGene: Mm.258622

Related Products

Tdo2 Proteins

Tdo2 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.