Recombinant Mouse Versican core protein (Vcan), partial

In Stock
Code CSB-EP720284MO
Abbreviation Recombinant Mouse Vcan protein, partial
MSDS
Size $388
Order now
Image
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP720284MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP720284MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Vcan
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Vcan; Cspg2Versican core protein; Chondroitin sulfate proteoglycan core protein 2; Chondroitin sulfate proteoglycan 2; Large fibroblast proteoglycan; PG-M
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
24-146aa
Target Protein Sequence
AKMETSPPVKGSLSGKVVLPCHFSTLPTLPPNYNTSEFLRIKWSKMEVDKNGKDIKETTVLVAQNGNIKIGQDYKGRVSVPTHPDDVGDASLTMVKLRASDAAVYRCDVMYGIEDTQDTMSLA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.9 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The preparation of this recombinant Mouse Vcan protein was to use gene recombination DNA technology to obtain a recombinant vector connected with a Vcan fragment (24-146aa) that could be translated into the Vcan protein and then transferred it into E.coli cells to express the recombinant Vcan protein molecule. In order to get the target protein with high purity, N-terminal 10xHis tag & C-terminal Myc tag was used in the production. The purity is 85% determined by SDS-PAGE.

VCAN, a large aggregating chondroitin sulfate proteoglycan belonging to the lexicon family, is an important extracellular matrix component, and is closely associated with tumorigenes. Four VCAN isoforms have been identified. The full-length isoform is V0, and the smaller isoforms V1, V2, and V3 result from alternative splicing. Previous studies have demonstrated that VCAN improves tumor cell survival, growth, migration, invasion, angiogenesis, and metastasis. Increased expression of VCAN has been reported in several malignancies, including leukemias as well as brain, colon, liver, prostate, breast, ovarian, oral squamous cell, and lung cancers, and is associated with adverse outcomes. A recent bioinformatic analysis revealed that VCAN may have an oncogenic role in GC, while another study suggested that VCAN expression predicts favorable outcomes in patients with GC.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Does the "Recombinant Mouse Versican core protein (Vcan)" has GAG-beta region or GAG-alpha region?

A:

Our instock products neither cover GAG-beta region nor GAG-alpha region. However, we can provide risk-based customized services for the recombinant mouse Versican core protein (Vcan) that covers the GAG-alpha region (348-1308aa).$861 is charged for fail expression. Only the protein, not the plasmid, will be provided for successful expression. The fee for successful expression is as follows:

Recombinant Mouse Versican core protein(Vcan), partial (348-1308aa)
CSB-YP720284MO1 >> Yeast   $2424/mg $1167/100ug $988/20ug 53-63 working days
CSB-EP720284MO1 >> E.coli    $2298/mg $1221/100ug $1005/20ug 53-63 working days
CSB-BP720284MO1>> Baculovirus $3313/mg $1665/100ug $1145/20ug  53-68 working days
CSB-MP720284MO1 >> Mammalian cell   $4662/500ug $2123/100ug $1319/20ug 53-63 working days

Tag information:
Tag type will be determined during the manufacturing process.
Target Protein Sequence(The complete sequence will be providedupon request, including tag sequence, target protein sequence and linker sequence):
PKQNISEATTIEMNILAETSSPSLSKEPHMVPDRATPVIPLATELPIFTTHFPPAGNIVNSEQKSVVYSQAITGRLATESPTTTRNTINSWDLNDSLASGSGPLGMPDISEIKEEELRSTTVISQHATGSQAVITEDTQTHESVSQIEQIEVGPLVTSMEITNHISLKELPEKNKTPYESTEVTLEHTTEMPTVSASPELATTSHYGFTLREDDREDRTLTVRSDQSTRVFSQIPEVITVSKTSEDTTYSQLGDLESISTSTITMLGTDRSLIDKEKEPKTNGKVTEDEFGQSQPTTTFPSQHLTEVELLPYSGDTTSVEGISTVIYPSLQTDVTQGRERTETPRPELKKDPYTVDEIPEKVTKDPFIGKTEEVFSGMPLSTSSSESSVERTESVSPALTIEKLTGKPTEARDVEEMTTLTRLETDVTKSDKDVTRVHLTHSTLNVEVVTVSKWPGDEDNSTSKPLPSTEHAGFTKLPPVPLSTIGINGKDKEIPSFTDGGGEYTLFPDGTPKPLEKVSEEDLASGELTVTFHTSTSIGSAEKSASGEPTTGDRFLPTTSTEDQVINATAEGSALGEDTEASKPLFTGPPFVHTSDVEELAFVNYSSTQEPTTYVDISHTSPLSIIPKTEWSVLETSVPLEDEILGKSDQDILEQTHLEATMSPGALRTTGVSQGETQEEPQTPGSPFPTFSSTAVMAKETTAFEEGEGSTYTPSEGRLMTGSERVPGLETTPVGTSYPPGAITDQEVEMDTMVTLMSTIRPTVVSSTESEVIYEAEGSSPTEFASTLRPFQTHVTQLMEETTEEGKKASLDYTDLGSGLFEPRATELPKFPSTPSDISVFTAIDSLHRTPPLSPSSSFTEEQRVFEEESSEKTTGDILPGESVTQHPVTTLIDIVAMKTESDIDHMTSKPPVTQPTRPSVVERKTTSKTQELSTSTPAAGTKFHPDINVYIIEVRENKTG

Target Background

Function
May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.
Subcellular Location
Secreted, extracellular space, extracellular matrix. Cell projection, cilium, photoreceptor outer segment. Secreted, extracellular space, extracellular matrix, interphotoreceptor matrix.
Protein Families
Aggrecan/versican proteoglycan family
Tissue Specificity
Expressed in the retina (at protein level). Isoform V2: Only expressed in brain.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*