Recombinant Mouse Lymphocyte activation gene 3 protein (Lag3), partial, Biotinylated

In Stock
Code CSB-MP720261MO-B
Abbreviation Recombinant Mouse Lag3 protein, partial, Biotinylated
MSDS
Size $164
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
LAG-3;Activation-induced cytidine deaminase-linked autoimmunity protein;Aida;CD antigen CD223;sLAG-3
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
24-422aa
Target Protein Sequence
GPGKELPVVWAQEGAPVHLPCSLKSPNLDPNFLRRGGVIWQHQPDSGQPTPIPALDLHQGMPSPRQPAPGRYTVLSVAPGGLRSGRQPLHPHVQLEERGLQRGDFSLWLRPALRTDAGEYHATVRLPNRALSCSLRLRVGQASMIASPSGVLKLSDWVLLNCSFSRPDRPVSVHWFQGQNRVPVYNSPRHFLAETFLLLPQVSPLDSGTWGCVLTYRDGFNVSITYNLKVLGLEPVAPLTVYAAEGSRVELPCHLPPGVGTPSLLIAKWTPPGGGPELPVAGKSGNFTLHLEAVGLAQAGTYTCSIHLQGQQLNATVTLAVITVTPKSFGLPGSRGKLLCEVTPASGKERFVWRPLNNLSRSCPGPVLEIQEARLLAERWQCQLYEGQRLLGATVYAAE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.7 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-Avi-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Lymphocyte activation gene 3 protein: Inhibitory receptor on antigen activated T-cells. Delivers inhibitory signals upon binding to ligands, such as FGL1. FGL1 constitutes a major ligand of LAG3 and is responsible for LAG3 T-cell inhibitory function. Following TCR engagement, LAG3 associates with CD3-TCR in the immunological synapse and directly inhibits T-cell activation. May inhibit antigen-specific T-cell activation in synergy with PDCD1/PD-1, possibly by acting as a coreceptor for PDCD1/PD-1. Negatively regulates the proliferation, activation, effector function and homeostasis of both CD8(+) and CD4(+) T-cells. Also mediates immune tolerance: constitutively expressed on a subset of regulatory T-cells (Tregs) and contributes to their suppressive function. Also acts as a negative regulator of plasmacytoid dendritic cell (pDCs) activation. Binds MHC class II (MHC-II); the precise role of MHC-II-binding is however unclear.; May function as a ligand for MHC class II (MHC-II) on antigen-presenting cells (APC), promoting APC activation/maturation and driving Th1 immune response.
Gene References into Functions
  1. upregulated in the central nervous system by intraepithelial lymphocytes from the gut epithelium of myelin oligodendrocyte glycoprotein(35-55)-specific T-cell receptor transgenic mice PMID: 27198196
  2. thi study shows that LAG-3 directly modulates the size of the T cell response and support the use of LAG-3 blockade regimens to enhance CD8+ T cell responses PMID: 27206765
  3. Study suggests that expression of the inhibitory receptors PD-1 and LAG-3 on CD4(+) T cells and their reduced IL-2 production are common characteristic features of Plasmodium infection. PMID: 26696540
  4. An IL-27/Lag3 axis enhances Foxp3+ regulatory T cell-suppressive function and therapeutic efficacy. PMID: 26013006
  5. LAG3 and PD1 co-inhibitory molecules have roles in collaborating to limit CD8+ T cell signaling and dampen antitumor immunity in a murine ovarian cancer model PMID: 26318293
  6. Poxvirus-Based Active Immunotherapy with PD-1 and LAG-3 Dual Immune Checkpoint Inhibition Overcomes Compensatory Immune Regulation, Yielding Complete Tumor Regression in Mice. PMID: 26910562
  7. Lymphatic endothelial cells (LECs) serve as an antigen reservoir for CD4 T-cell tolerance, and MHC-II molecules on LECs are used to induce CD8 T-cell tolerance via LAG-3. PMID: 25857745
  8. LAG-3 expression on Tconv cells makes them more susceptible to Treg based suppression, and also regulates the development of a TH1 T-cell response. PMID: 25372844
  9. LAG-3 exerts an important regulatory effect on autoimmunity. PMID: 25122007
  10. Lag-3 is an important regulatory molecule involved in alloreactive T cell proliferation and activation after bone marrow transplantation. PMID: 24475140
  11. these results define a strong synergy between the PD-1 and LAG-3 inhibitory pathways in tolerance to both self and tumor antigens. PMID: 22186141
  12. We conclude that LAG-3 is necessary for regulating CD4(+) and CD8(+) T cell function during autoimmune diabetes PMID: 21873518
  13. LAG-3 is required for long-term peripheral CD8 but not CD4 T-cell tolerance and this requirement is CD8 cell-extrinsic. PMID: 21422469
  14. LAG-3 acts synergistically with PD-1 and/or other immunoregulatory genes to prevent autoimmunity in mice. PMID: 21300912
  15. This significant intracellular storage of LAG-3 appears to facilitate its rapid translocation to the cell surface following T-cell activation, which was much faster for LAG-3 than CD4 PMID: 20391435
  16. blockade of LAG-3 did not rescue cytokine production by virus-specific CD8 T cells and did not alter the virus titer in various organs PMID: 19880580
  17. Lag3 inhibits CD4-dependent, but not CD4-independent, T cell function via its cytoplasmic domain. PMID: 12421911
  18. LAG-3 regulates the expansion of activated T cells. PMID: 12672063
  19. LAG-3 activates antigen-presenting cells through MHC class II signalling, leading to increased antigen-specific T-cell responses in vivo. PMID: 14644131
  20. data suggest that LAG-3 negatively regulates T cell expansion and controls the size of the memory T cell pool PMID: 15100286
  21. LAG-3 marks regulatory T cell populations and contributes to their suppressor activity PMID: 15485628
  22. LAG-3 is cleaved within the D4 transmembrane domain connecting peptide into two fragments that remain membrane associated. Modulation of LAG-3 cleavage may contribute to the function of this key regulatory T cell protein. PMID: 15557174
  23. LAG-3 negatively regulates T cell homeostasis by regulatory T cell-dependent and independent mechanisms. PMID: 15634887
  24. LAG-3 is a new marker of T cell induced B cell activation. PMID: 15971272
  25. Metalloprotease-mediated cleavage of LAG-3 controls T-cell proliferation and immune response. PMID: 17245433
  26. Data demonstrate a direct role for LAG-3 on CD8+ T cells and suggest that LAG-3 blockade may be a potential cancer treatment. PMID: 17932562
  27. a novel ITAM-mediated inhibitory signaling pathway in DCs triggered by MHC II engagement of LAG-3, providing a molecular mechanism in which regulatory T cells may suppress via modulating DC function. PMID: 18424711
  28. LAG-3 plays an important but selective cell intrinsic and cell extrinsic role in plasmacytoid dendritic cells biology PMID: 19201841
  29. signaling through the PD-1 and LAG-3 pathways have distinct functional consequences to CD8 T cells under tolerizing conditions PMID: 19454660

Show More

Hide All

Subcellular Location
[Lymphocyte activation gene 3 protein]: Cell membrane; Single-pass type I membrane protein.; [Secreted lymphocyte activation gene 3 protein]: Secreted.
Tissue Specificity
Primarily expressed in activated CD4(+) and CD8(+) T-cells. Also expressed in a subset of regulatory T-cells (Tregs), such as natural CD4(+)CD25(+) Tregs. Also expressed on plasmacytoid dendritic cells (pDCs).
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*