Recombinant Mouse Interferon alpha/beta receptor 2 (Ifnar2), partial

In Stock
Code CSB-YP011047MO
Abbreviation Recombinant Mouse Ifnar2 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Alternative Names
Ifnar2; Interferon alpha/beta receptor 2; IFN-R-2; IFN-alpha/beta receptor 2; Type I interferon receptor 2
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
22-242aa
Target Protein Sequence
SLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKSGPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTVCRCSDYIVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDSVRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGLSESA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.8 kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Interferon alpha/beta receptor 2 (Ifnar2) is produced in a yeast expression system and spans the extracellular domain from amino acids 22 to 242. The protein carries an N-terminal 6xHis-tag and shows purity levels exceeding 90%, as confirmed by SDS-PAGE analysis. This protein is intended strictly for research purposes and contains no detectable endotoxin, which appears to make it suitable for various experimental applications.

Interferon alpha/beta receptor 2 (Ifnar2) represents a critical component of the interferon signaling pathway. It likely plays a central role in mediating cellular responses to type I interferons. The protein participates in several cellular processes, including antiviral defense and immune response modulation. Its research significance stems from its involvement in immune regulation studies and host-pathogen interaction research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, recombinant mouse Ifnar2 extracellular domain (22-242aa) is produced in a yeast expression system with an N-terminal 6xHis-tag. Yeast expression systems provide eukaryotic folding machinery capable of supporting disulfide bond formation and glycosylation, which are critical for the structural integrity and function of interferon receptor extracellular domains. The defined "Extracellular Domain" region suggests the construct is designed to include the functional ligand-binding portion of Ifnar2. However, as a soluble fragment lacking the transmembrane and intracellular domains, it may not fully replicate the conformational constraints of the membrane-bound receptor. Purity >90% by SDS-PAGE under denaturing conditions does not confirm native folding or bioactivity. No validation data (e.g., interferon binding assays, circular dichroism) are provided. Therefore, while yeast expression increases the probability of correct folding, the protein's structural and functional integrity cannot be guaranteed without experimental validation.

1. Interferon Receptor Binding Studies

If correctly folded, this recombinant Ifnar2 extracellular domain could be used to study interferon binding interactions using techniques like surface plasmon resonance. However, the His-tag may sterically hinder the binding interface or alter conformation, potentially affecting affinity measurements. If misfolded, binding studies would yield biologically irrelevant data. Validation of folding and direct comparison with tag-free protein are essential for reliable results.

2. Antibody Development and Characterization

This application is suitable, as antibody generation primarily relies on linear epitope recognition. The extracellular domain provides relevant epitopes for antibodies targeting the receptor's functional region. However, if misfolded, antibodies may not recognize conformational epitopes critical for blocking interferon binding in native receptors.

3. Protein-Protein Interaction Analysis

If properly folded, the protein could identify interaction partners, but the soluble extracellular domain may lack context-dependent interactions present in full-length membrane receptors. If misfolded, pull-down assays may capture non-specific binders. Interactions should be validated with full-length receptors in cellular contexts.

4. Structural and Biophysical Characterization

If correctly folded, structural studies are feasible, but the His-tag should be removed to avoid interference. If misfolded, structural data would misrepresent the native receptor. Biophysical analyses must be interpreted cautiously, as solution properties may differ from membrane-bound states.

Final Recommendation & Action Plan

This yeast-expressed Ifnar2 extracellular domain has a reasonable chance of proper folding but requires validation before functional applications. Implement the following: 1) Confirm folding via circular dichroism (secondary structure) and size-exclusion chromatography ( oligomeric state); 2) Validate bioactivity using interferon binding assays with positive controls; 3) For critical binding/interaction studies, remove the His-tag proteolytically and compare with tagged protein; 4) Use antibody development applications immediately, but validate antibodies against native cellular Ifnar2. If validation fails, consider mammalian-expressed extracellular domains for higher physiological relevance.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Associates with IFNAR1 to form the plasma membrane receptor in the type I interferon signaling pathway. Directly involved in signal transduction through its association with the TYR kinase JAK1. Involved in interferon-mediated STAT1, STAT2 and STAT3 activation.; May be potent inhibitors of type I IFN receptor activity.; May be potent inhibitors of type I IFN receptor activity.
Gene References into Functions
  1. We found that STAT-1(-/-) MRL lpr m, but not IRF-9(-/-) or IFNAR-2(-/-) mice, developed interstitial nephritis characterized by infiltration with RORgammat-positive lymphocytes, macrophages, and eosinophils. PMID: 26636548
  2. mTORC2 has a central role in IFNgamma signaling and type II IFN responses PMID: 26645692
  3. In this study, we elucidate the in vivo importance of the soluble type I IFNAR, soluble (s)IFNAR2a PMID: 24696235
  4. In this study we have characterized the Stat2-IFNaR2 interaction and examined its role in IFNalpha signaling PMID: 11786546
  5. regions in promoter that confer basal and inducible expression PMID: 11939908
  6. studies reveal that a single conserved IFNAR2 tyrosine, Y(510), plays a critical role in directing the IFN-I-dependent activation of STAT1 and STAT2, both in murine fibroblasts and macrophages PMID: 18390731
  7. Our studies provide a critical link between the IFN-I pathway and the regulation of TLR-specific B-cell responses in a murine model of Systemic lupus erythematosus PMID: 19624844
  8. ability of L. pneumophila to induce IFN-I expression was found to be dependent on IRF-3, but not NF-kappaB. Secreted IFN-Is then in turn suppress the intracellular replication of L. pneumophila PMID: 19720834

Show More

Hide All

Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.; [Isoform 3]: Secreted.
Protein Families
Type II cytokine receptor family
Tissue Specificity
Widely expressed. Detected in liver, testis, kidney, salivary gland, thymus, brain, lung and placenta. Isoform 1, isoform 2 and isoform 3 are expressed in brain.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*