Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

fbpA

Uniprot No.

P9WQP2

Research Area

Others

Alternative Names

fbpA; mpt44; MT3911Diacylglycerol acyltransferase/mycolyltransferase Ag85A; DGAT; EC 2.3.1.122; EC 2.3.1.20; Acyl-CoA:diacylglycerol acyltransferase; Antigen 85 complex A; 85A; Ag85A; Fibronectin-binding protein A; Fbps A

Species

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Source

E.coli

Expression Region

53-331aa

Target Protein Sequence

YLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPNT
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

34.1kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

Has this been tested for endotoxins?

Very nice to receive your inquiry. We could use conjugated PMB affinity filler adsorption to remove endotoxin and guarantee endotoxin level within 0.1ng / ug (1EU / ug).
If customer would perform cell relevant experiment, we could provide Endotoxin Removal Service and Aseptic Manufacture Processing free of charge. The details are as below.
Please kindly remark "Endotoxin Removal Service & Aseptic Manufacture Processing" in your PO.
Endotoxin Removal Service
*If customer plans to use a protein in cell culture, please check with us if it has been endotoxin tested and if it is suitable for this purpose.
*If customer has requirement for endotoxin level, please remark this information when placing the order and we could offer endotoxin removal service free of charge.
*We use conjugated PMB affinity filler adsorption to remove endotoxin and guarantee endotoxin level within 0.1ng / ug (1EU / ug).
*Generally, the delivery time will be extended for 2-3 working days.
*Endotoxin removal result will be shown in COA as follows “<1.0 EU per 1μg of the protein by the LAL method.”
Aseptic Manufacture Processing
*If customer plans to use a protein in cell culture, please check with them if aseptic manufacture processing is required. If customer has demand for aseptic manufacture processing, then please remark this
information when placing the order.
*We could offer aseptic manufacture processing service free of charge.
*The delivery time won’t be extended.
*We've performed Aseptic processing for liquid protein, before lyophilization, but there may exist contamination during lyophilization process, so we can't say bacteria free for the whole process.
*Aseptic manufacture processing will be shown in both of datasheet & COA as follows “0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, pH 8.0, 50% glycerol”.

Target Background

Function

The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria for fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan, and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM. FbpA mediates triacylglycerol (TAG) formation with long-chain acyl-CoA as the acyl donor and 1,2-dipalmitoyl-sn-glycerol (1,2-dipalmitin) as the acyl acceptor.

Subcellular Location

Secreted, cell wall. Cytoplasm.

Protein Families

Mycobacterial A85 antigen family

Database Links

KEGG: mtc:MT3911

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address