Home
Protein
Recombinant Protein
Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85A (fbpA)

Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85A (fbpA)

^{In Stock} ^Promotion

Code	CSB-EP358584MVZ
MSDS	MSDS
Size	US$388
	Order now
Promotion
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

fbpA

Uniprot No.

P9WQP2

Research Area

Microbiology

Alternative Names

fbpA; mpt44; MT3911Diacylglycerol acyltransferase/mycolyltransferase Ag85A; DGAT; EC 2.3.1.122; EC 2.3.1.20; Acyl-CoA:diacylglycerol acyltransferase; Antigen 85 complex A; 85A; Ag85A; Fibronectin-binding protein A; Fbps A

Species

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Source

E.coli

Expression Region

44-338aa

Target Protein Sequence

FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

44.6 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The region for expressing recombinant Mycobacterium tuberculosis fbpA contains amino acids 44-338. This fbpA protein is expected to have a theoretical molecular weight of 44.6 kDa. This protein is generated in a e.coli-based system. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of fbpA, which enables a simple process of detecting and purifying the fbpA recombinant protein in the following steps.

The Mycobacterium tuberculosis diacylglycerol acyltransferase/mycolyltransferase Ag85A, encoded by the fbpA gene, is a crucial enzyme involved in the biosynthesis of mycolic acids. Mycolic acids contribute to the unique structure and impermeability of the mycobacterial cell envelope, playing a critical role in the pathogenesis and virulence of Mycobacterium tuberculosis (Mtb), the causative agent of tuberculosis. Ag85A is responsible for transferring mycolic acids to arabinogalactan, forming the mycolyl-arabinogalactan-peptidoglycan complex. This enzymatic activity is vital for the integrity of the mycobacterial cell wall and its ability to evade host immune responses. Understanding the function of Ag85A is essential for developing targeted therapies against tuberculosis and provides valuable insights into the molecular mechanisms underlying Mtb pathogenicity.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria for fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan, and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM. FbpA mediates triacylglycerol (TAG) formation with long-chain acyl-CoA as the acyl donor and 1,2-dipalmitoyl-sn-glycerol (1,2-dipalmitin) as the acyl acceptor.

Subcellular Location

Secreted, cell wall. Cytoplasm.

Protein Families

Mycobacterial A85 antigen family

Database Links

KEGG: mtc:MT3911

Promotions