Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Microbiology
Alternative Names
fbpA; mpt44; MT3911Diacylglycerol acyltransferase/mycolyltransferase Ag85A; DGAT; EC 2.3.1.122; EC 2.3.1.20; Acyl-CoA:diacylglycerol acyltransferase; Antigen 85 complex A; 85A; Ag85A; Fibronectin-binding protein A; Fbps A
Species
Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Expression Region
44-338aa
Target Protein Sequence
FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Mycobacterium tuberculosis fbpA contains amino acids 44-338. This fbpA protein is expected to have a theoretical molecular weight of 44.6 kDa. This protein is generated in a e.coli-based system. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of fbpA, which enables a simple process of detecting and purifying the fbpA recombinant protein in the following steps.
The Mycobacterium tuberculosis diacylglycerol acyltransferase/mycolyltransferase Ag85A, encoded by the fbpA gene, is a crucial enzyme involved in the biosynthesis of mycolic acids. Mycolic acids contribute to the unique structure and impermeability of the mycobacterial cell envelope, playing a critical role in the pathogenesis and virulence of Mycobacterium tuberculosis (Mtb), the causative agent of tuberculosis. Ag85A is responsible for transferring mycolic acids to arabinogalactan, forming the mycolyl-arabinogalactan-peptidoglycan complex. This enzymatic activity is vital for the integrity of the mycobacterial cell wall and its ability to evade host immune responses. Understanding the function of Ag85A is essential for developing targeted therapies against tuberculosis and provides valuable insights into the molecular mechanisms underlying Mtb pathogenicity.
