Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64 (mpt64)

In Stock
Code CSB-EP358713FSG
Abbreviation Recombinant Mycobacterium tuberculosis mpt64 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
mpt64
Uniprot No.
Alternative Names
mpt64; MT2032; Immunogenic protein MPT64; Antigen MPT64
Species
Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Source
E.coli
Expression Region
24-228aa
Target Protein Sequence
APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.4kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64 (mpt64) is expressed in E. coli and includes an N-terminal 6xHis-tag that makes purification more straightforward. The protein covers the complete mature protein sequence, spanning amino acids 24-228. Purity levels exceed 90%, as confirmed through SDS-PAGE analysis. This product is intended for research purposes only and provides consistent quality for experimental work.

MPT64 appears to be a significant immunogenic protein from Mycobacterium tuberculosis that plays a role in how the pathogen interacts with host immune systems. Researchers often turn to this protein when studying tuberculosis because it may offer insights into host-pathogen dynamics and immune response mechanisms. Many studies focus on MPT64 to better understand tuberculosis pathogenesis, which could potentially inform the development of diagnostic tools and therapeutic approaches.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant Mycobacterium tuberculosis immunogenic protein MPT64 is expressed in E. coli, a prokaryotic system that is generally suitable for expressing bacterial proteins like MPT64, as it may not require complex eukaryotic-specific post-translational modifications. The protein is expressed as the full-length mature protein (24-228aa), which increases the likelihood of correct folding. However, since the protein's activity is unknown and unvalidated, it cannot be guaranteed to be correctly folded or bioactive. MPT64 may require specific disulfide bond formation or proper folding for its immunogenic properties, and E. coli expression systems can sometimes produce misfolded or insoluble proteins. Therefore, while the probability of correct folding is reasonably high, experimental validation is essential to confirm bioactivity (e.g., immunogenicity or binding assays).

1. Antibody Development and Characterization

This recombinant MPT64 protein can work as an immunogen for generating antibodies, as antibodies often recognize linear epitopes that are less dependent on native folding. The N-terminal 6xHis tag facilitates purification and immobilization for screening assays, and the high purity (>90%) minimizes contamination risks. However, if the protein is misfolded, the resulting antibodies may not recognize the native, conformationally intact MPT64 in M. tuberculosis cells or physiological contexts. Antibody validation should include testing against native MPT64 to ensure specificity for relevant epitopes.

2. Protein-Protein Interaction Studies

The 6xHis tag allows for immobilization on nickel-affinity resins for pull-down experiments, but this application is highly dependent on correct protein folding. If MPT64 is misfolded, it may not interact authentically with biological partners from M. tuberculosis extracts, leading to non-physiological interactions or false negatives. The high purity reduces background, but results should be interpreted cautiously until folding is validated. If correctly folded, this approach is feasible; otherwise, it may yield misleading data.

3. Biochemical Characterization and Stability Studies

This application is appropriate and should be prioritized to assess protein folding. Techniques like circular dichroism spectroscopy and dynamic light scattering can directly evaluate secondary structure, oligomeric state, and stability. The high purity supports reliable measurements. Even if the protein is misfolded, these studies provide valuable insights into the recombinant product's properties. Such analyses can inform the feasibility of other applications.

4. ELISA-Based Binding Assays

The recombinant protein can be used in ELISA assays, but the outcomes depend on folding. The 6xHis tag enables standardized immobilization, but if MPT64 is misfolded, binding studies with molecules (e.g., antibodies, peptides) may not reflect native interactions, particularly if conformational epitopes are involved. The high purity minimizes interference, but assays should be designed for linear epitope screening or validated with native protein controls. For studies requiring native conformation, folding must be confirmed first.

Final Recommendation & Action Plan

Given the uncertainty in folding and bioactivity, the recommended plan is to first perform biochemical characterization (e.g., circular dichroism for secondary structure, size-exclusion chromatography for oligomeric state) and functional assays (e.g., testing immunogenicity in cell-based assays or binding to known partners) to confirm native conformation and activity. If validated, the protein can be reliably used for all described applications; if misfolded, focus on non-conformation-dependent uses like antibody development for linear epitopes or as a denatured control in Western blotting. Always include appropriate controls, such as native MPT64 when available, and consider using eukaryotic expression systems if folding issues are detected for activity-critical studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. Aptamers against Mtb secreted protein MPT64 were successfully selected and could be used as an alternative for detection and diagnosis of tuberculosis. PMID: 28454652
  2. we found that polymorphisms of the mpt64 gene in the MTBC may be the reason for changes in the antigen produced, which may in turn cause alterations of related functions, thereby allowing immune evasion. PMID: 23390287
  3. CFP21 (cutinase precursor) and MPT64 fusion protein stimulate higher level of interferon (IFN)-gamma in tuberculin skin test (TST)-positive healthy population than in TST-negative healthy population. PMID: 21340709
  4. Data show that Recombinant Mycobacterium vaccae secreted MPT64 could induce high level humoral and cell mediated immune responses in mice and could be used as a candidate of new vaccine against TB. PMID: 19257983
  5. Recombinant rMPT64 elicits a specific immune response indistinguishable from that of MPB64 purified from BCG Tokyo culture filtrates. PMID: 16216527

Show More

Hide All

Subcellular Location
Secreted.
Database Links

KEGG: mtu:Rv1980c

STRING: 83332.Rv1980c

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*