Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64 (mpt64)

In Stock
Code CSB-BP358713FSGb0
Abbreviation Recombinant Mycobacterium tuberculosis mpt64 protein
MSDS
Size $528
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
mpt64
Uniprot No.
Alternative Names
mpt64; MT2032; Immunogenic protein MPT64; Antigen MPT64
Species
Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Source
Baculovirus
Expression Region
24-228aa
Target Protein Sequence
APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : /

Review: MPT64 and CFP10 peroxidase-labeled secondary antibodies were purchased from Cusabio (Wuhan, China).The effects of the experimental variables for the dual CFP10 and MPT64 aptasensor were studied for each target antigen.

By Anonymous

Target Background

Gene References into Functions
  1. Aptamers against Mtb secreted protein MPT64 were successfully selected and could be used as an alternative for detection and diagnosis of tuberculosis. PMID: 28454652
  2. we found that polymorphisms of the mpt64 gene in the MTBC may be the reason for changes in the antigen produced, which may in turn cause alterations of related functions, thereby allowing immune evasion. PMID: 23390287
  3. CFP21 (cutinase precursor) and MPT64 fusion protein stimulate higher level of interferon (IFN)-gamma in tuberculin skin test (TST)-positive healthy population than in TST-negative healthy population. PMID: 21340709
  4. Data show that Recombinant Mycobacterium vaccae secreted MPT64 could induce high level humoral and cell mediated immune responses in mice and could be used as a candidate of new vaccine against TB. PMID: 19257983
  5. Recombinant rMPT64 elicits a specific immune response indistinguishable from that of MPB64 purified from BCG Tokyo culture filtrates. PMID: 16216527

Show More

Hide All

Subcellular Location
Secreted.
Database Links

KEGG: mtu:Rv1980c

STRING: 83332.Rv1980c

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*