Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64(mpt64)

In Stock
Code CSB-YP358713FSG
Size US$1916
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP358713MVZ could indicate that this peptide derived from Yeast-expressed Mycobacterium tuberculosis mpt64.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP358713MVZ could indicate that this peptide derived from Yeast-expressed Mycobacterium tuberculosis mpt64.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Description

The cDNA fragment encoding 24-228aa of Mycobacterium tuberculosis immunogenic protein MPT64 was fused with an N-terminal 6xHis-tag and then expressed in the yeast cells. The product obtained is the recombinant full-length of mature Mycobacterium tuberculosis MPT64 protein. Its purity was determined using SDS-PAGE and reached up to 90%. Under the reducing conditions, the gel presented a molecular mass band of about 21-24 kDa. It also underwent the validation through the LC-MS/MS analysis. In-stock MPT64 proteins are offered now. This recombinant MPT64 protein may find uses in the specific antibody production or the studies of tuberculosis (TB) infection.

The level of expression of the MPT64 protein is high in patients with active TB. Both in sputum and serum exosomes of a TB infected patient can be detected the presence of MPT64. A special receptor, single-stranded DNA (ssDNA) aptamer, can specifically recognize MPT64 protein. MPT64 mainly promotes survival and persistence in the host cell. It deactivates the expression of apoptotic cytokines and plays a major role in the survival and virulence of the mycobacteria.

Purity Greater than 90% as determined by SDS-PAGE.
Target Names mpt64
Uniprot No. P9WIN9
Alternative Names
mpt64; MT2032; Immunogenic protein MPT64; Antigen MPT64
Species Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Source Yeast
Expression Region 24-228aa
Target Protein Sequence APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 24.4kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer Tris-based buffer,50% glycerol
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time 3-7 business days
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. Aptamers against Mtb secreted protein MPT64 were successfully selected and could be used as an alternative for detection and diagnosis of tuberculosis. PMID: 28454652
  2. we found that polymorphisms of the mpt64 gene in the MTBC may be the reason for changes in the antigen produced, which may in turn cause alterations of related functions, thereby allowing immune evasion. PMID: 23390287
  3. CFP21 (cutinase precursor) and MPT64 fusion protein stimulate higher level of interferon (IFN)-gamma in tuberculin skin test (TST)-positive healthy population than in TST-negative healthy population. PMID: 21340709
  4. Data show that Recombinant Mycobacterium vaccae secreted MPT64 could induce high level humoral and cell mediated immune responses in mice and could be used as a candidate of new vaccine against TB. PMID: 19257983
  5. Recombinant rMPT64 elicits a specific immune response indistinguishable from that of MPB64 purified from BCG Tokyo culture filtrates. PMID: 16216527

Show More

Hide All

Subcellular Location Secreted.
Database Links

KEGG: mtu:Rv1980c

STRING: 83332.Rv1980c

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St Ste 610-322 Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2023 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1