Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64 (mpt64)

In Stock
Code CSB-YP358713FSG
Abbreviation Recombinant Mycobacterium tuberculosis mpt64 protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP358713MVZ could indicate that this peptide derived from Yeast-expressed Mycobacterium tuberculosis mpt64.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP358713MVZ could indicate that this peptide derived from Yeast-expressed Mycobacterium tuberculosis mpt64.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
mpt64
Uniprot No.
Alternative Names
mpt64; MT2032; Immunogenic protein MPT64; Antigen MPT64
Species
Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Source
Yeast
Expression Region
24-228aa
Target Protein Sequence
APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.4kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant Mycobacterium tuberculosis Immunogenic protein MPT64 gets expressed in a yeast system and covers the full length of the mature protein from amino acids 24 to 228. An N-terminal 6xHis-tag is included to make purification and detection more straightforward. SDS-PAGE analysis confirms the protein shows purity greater than 90%, which should provide reliable performance in research applications.

MPT64 appears to be a well-characterized immunogenic protein from Mycobacterium tuberculosis that researchers have studied extensively for its role in the immune response to tuberculosis. It represents a significant component in understanding how hosts and pathogens interact and seems crucial for developing diagnostic tools and vaccines. The research community has found that MPT64 helps clarify tuberculosis pathogenesis and immunity, though much remains to be discovered.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Characterization

This recombinant MPT64 protein may serve as an immunogen for generating polyclonal or monoclonal antibodies specific to Mycobacterium tuberculosis. The high purity (>90%) and N-terminal 6xHis tag likely make it suitable for immunization protocols and subsequent antibody purification using affinity chromatography. Since the expressed mature protein region (24-228aa) represents the native antigenic form, antibodies generated should recognize the natural MPT64 protein. These antibodies could become valuable research tools for studying M. tuberculosis infection mechanisms and protein localization studies.

2. ELISA-Based Binding Assays

The N-terminal 6xHis tag allows direct immobilization of the protein onto nickel-coated ELISA plates for screening potential binding partners or inhibitors. Researchers might use this system to investigate protein-protein interactions involving MPT64 or to screen compound libraries for molecules that bind to this mycobacterial protein. The high purity level should minimize background interference in binding assays. This approach may provide insights into MPT64's molecular interactions within the mycobacterial proteome or with host cell components, though some interactions could be missed due to the artificial conditions.

3. Immunoblotting and Protein Detection Studies

This recombinant protein works as a positive control and molecular weight standard in Western blot experiments investigating MPT64 expression in M. tuberculosis cultures or clinical isolates. The known protein length and His-tag allow for precise identification using both anti-MPT64 antibodies and anti-His tag antibodies. Researchers can use this protein to validate antibody specificity and optimize detection protocols for studying MPT64 expression under different growth conditions or stress responses.

4. Affinity Purification and Pull-Down Experiments

The 6xHis tag makes it possible to immobilize MPT64 onto nickel-affinity resins for pull-down experiments to identify interacting proteins from M. tuberculosis lysates or host cell extracts. This approach might help clarify the protein interaction network involving MPT64 during mycobacterial infection or metabolism. The high purity of the recombinant protein should reduce non-specific binding, improving the reliability of identifying genuine interaction partners through mass spectrometry analysis of pulled-down complexes. However, some physiologically relevant interactions may be lost when the protein is removed from its native cellular context.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. Aptamers against Mtb secreted protein MPT64 were successfully selected and could be used as an alternative for detection and diagnosis of tuberculosis. PMID: 28454652
  2. we found that polymorphisms of the mpt64 gene in the MTBC may be the reason for changes in the antigen produced, which may in turn cause alterations of related functions, thereby allowing immune evasion. PMID: 23390287
  3. CFP21 (cutinase precursor) and MPT64 fusion protein stimulate higher level of interferon (IFN)-gamma in tuberculin skin test (TST)-positive healthy population than in TST-negative healthy population. PMID: 21340709
  4. Data show that Recombinant Mycobacterium vaccae secreted MPT64 could induce high level humoral and cell mediated immune responses in mice and could be used as a candidate of new vaccine against TB. PMID: 19257983
  5. Recombinant rMPT64 elicits a specific immune response indistinguishable from that of MPB64 purified from BCG Tokyo culture filtrates. PMID: 16216527

Show More

Hide All

Subcellular Location
Secreted.
Database Links

KEGG: mtu:Rv1980c

STRING: 83332.Rv1980c

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*