Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64 (mpt64)

In Stock
Code CSB-YP358713FSG
Abbreviation Recombinant Mycobacterium tuberculosis mpt64 protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP358713MVZ could indicate that this peptide derived from Yeast-expressed Mycobacterium tuberculosis mpt64.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP358713MVZ could indicate that this peptide derived from Yeast-expressed Mycobacterium tuberculosis mpt64.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
mpt64
Uniprot No.
Alternative Names
mpt64; MT2032; Immunogenic protein MPT64; Antigen MPT64
Species
Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Source
Yeast
Expression Region
24-228aa
Target Protein Sequence
APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.4kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant Mycobacterium tuberculosis Immunogenic protein MPT64 gets expressed in a yeast system and covers the full length of the mature protein from amino acids 24 to 228. An N-terminal 6xHis-tag is included to make purification and detection more straightforward. SDS-PAGE analysis confirms the protein shows purity greater than 90%, which should provide reliable performance in research applications.

MPT64 appears to be a well-characterized immunogenic protein from Mycobacterium tuberculosis that researchers have studied extensively for its role in the immune response to tuberculosis. It represents a significant component in understanding how hosts and pathogens interact and seems crucial for developing diagnostic tools and vaccines. The research community has found that MPT64 helps clarify tuberculosis pathogenesis and immunity, though much remains to be discovered.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Mycobacterium tuberculosis MPT64 is an immunogenic protein that requires proper folding for its antigenic properties and potential functional roles. The yeast expression system provides a eukaryotic environment that supports proper folding and some post-translational modifications, increasing the probability of correct folding compared to bacterial systems. The N-terminal 6xHis tag is relatively small and unlikely to significantly interfere with the protein's antigenic epitopes. While the protein may be correctly folded, experimental validation is recommended to confirm its structural integrity and antigenic activity.

1. Antibody Development and Characterization

This application is highly suitable regardless of folding status. Antibody development relies primarily on antigenic sequence recognition. If correctly folded (verified), the protein excels for generating conformation-sensitive antibodies that recognize native MPT64 epitopes. If misfolded/unverified, it remains suitable for producing antibodies against linear epitopes, which are still valuable for diagnostic and research applications.

2. ELISA-Based Binding Assays

This application is well-suited for immunological detection. If correctly folded (verified), the protein serves as an excellent antigen for detecting anti-MPT64 antibodies in serological assays. If misfolded/unverified, it remains effective as a coating antigen for ELISA since antibody binding primarily depends on linear epitopes.

3. Immunoblotting and Protein Detection Studies

This application is highly reliable. The recombinant protein works excellently as a positive control in Western blot experiments regardless of folding status. The known molecular weight and His-tag facilitate accurate identification and molecular weight standardization.

4. Affinity Purification and Pull-Down Experiments

This application requires folding validation. If correctly folded (verified), the protein can identify physiological interaction partners involved in M. tuberculosis pathogenesis. If misfolded/unverified, there is a high risk of non-specific binding or failure to identify genuine interactions.

Final Recommendation & Action Plan

The yeast expression system provides favorable conditions for producing correctly folded MPT64 protein, making it highly suitable for immunological applications. Begin with Applications 1, 2, and 3 for antibody development, ELISA assays, and immunoblotting controls, as these are reliable regardless of folding status. For Application 4 (interaction studies), first validate protein folding through biophysical characterization (e.g., circular dichroism spectroscopy, size-exclusion chromatography). Once correct folding is verified, proceed with pull-down experiments to identify genuine interaction partners. If misfolding is detected, limit the protein's use to immunological applications only.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. Aptamers against Mtb secreted protein MPT64 were successfully selected and could be used as an alternative for detection and diagnosis of tuberculosis. PMID: 28454652
  2. we found that polymorphisms of the mpt64 gene in the MTBC may be the reason for changes in the antigen produced, which may in turn cause alterations of related functions, thereby allowing immune evasion. PMID: 23390287
  3. CFP21 (cutinase precursor) and MPT64 fusion protein stimulate higher level of interferon (IFN)-gamma in tuberculin skin test (TST)-positive healthy population than in TST-negative healthy population. PMID: 21340709
  4. Data show that Recombinant Mycobacterium vaccae secreted MPT64 could induce high level humoral and cell mediated immune responses in mice and could be used as a candidate of new vaccine against TB. PMID: 19257983
  5. Recombinant rMPT64 elicits a specific immune response indistinguishable from that of MPB64 purified from BCG Tokyo culture filtrates. PMID: 16216527

Show More

Hide All

Subcellular Location
Secreted.
Database Links

KEGG: mtu:Rv1980c

STRING: 83332.Rv1980c

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*