Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
Alpha-cobratoxin; Alpha-CbT; alpha-CT; alpha-Cbtx; Alpha-elapitoxin-Nk2a; Alpha-EPTX-Nk2a; Long neurotoxin 1; Siamensis 3
Species
Naja kaouthia (Monocled cobra) (Naja siamensis)
Target Protein Sequence
IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPTRKRP
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Naja kaouthia Alpha-CT protein is encoded by the gene of Alpha-CT (1-71aa). The gene of Alpha-CT was cloned in a system (E.coli) that supported the expression of Alpha-CT. Modification of Alpha-CT by recombinant DNA technology could lead to the expression of the target protein. The protein was fused with N-terminal 10xHis-GST tag & C-terminal Myc tag in the production. The purity is 85% determined by SDS-PAGE.
Alpha-cobratoxin is a nicotinic acetylcholine receptor. According to some research, Alpha-cobratoxin may have the following features.
Alpha-cobratoxin as a possible treatment for multiple sclerosis. Alpha-cobratoxin inhibits the T-type calcium current of dorsal root ganglion neurons through the muscarinic M4 receptor and Go-protein βγ subunit-dependent protein kinase A pathway. Isolation and characterization of high-affinity VHH antibody fragments against alpha-cobratoxin.
