Home
Protein
Recombinant Proteins
Recombinant Neisseria meningitidis serogroup B Integration host factor subunit alpha (ihfA)

Recombinant Neisseria meningitidis serogroup B Integration host factor subunit alpha (ihfA)

^{In Stock}

Code	CSB-EP351432NGG
Abbreviation	Recombinant Neisseria meningitidis serogroup B ihfA protein
MSDS	MSDS Datasheet
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

ihfA

Uniprot No.

P64393

Research Area

Transcription

Species

Neisseria meningitidis serogroup B (strain MC58)

Source

E.coli

Expression Region

1-100aa

Target Protein Sequence

MTLTKAELADILVDKVSNVTKNDAKEIVELFFEEIRSTLASGEEIKISGFGNFQLRDKPQRPGRNPKTGEEVPITARRVVTFHASQKLKSMVEHYYDKQR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

15.5 kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The pipeline for the recombinant Neisseria meningitidis serogroup B (strain MC58) ihfA protein production in e.coli cells consists of the following consecutive steps: construction of the expression vector encoding the Neisseria meningitidis serogroup B (strain MC58) ihfA protein (1-100aa), its transformation into e.coli cells, high-density cultivation and induction of the positive cells, cell lysis, and expression analysis. The protein features a N-terminal 6xHis tag fusion. The resulting recombinant Neisseria meningitidis serogroup B (strain MC58) ihfA protein is purified from the cell lysate through affinity purification, and its purity is greater than 85% determined by the SDS-PAGE.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Protein Families

Bacterial histone-like protein family

Database Links

KEGG: nme:NMB0729

STRING: 122586.NMB0729

Promotions