Recombinant Peptidoglycan-associated lipoprotein(pal)

Code CSB-EP340792LNYa2
Product Type Recombinant Protein
Size US$2466
Uniprot No. P26493
Relevance Very strongly associated with the peptidoglycan
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias 19 kDa surface antigen PPL
Species Legionella pneumophila
Purity Greater than 90% as determined by SDS-PAGE.
Sequence CSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEPGESYTTQAPHNQLYLFAYDDSTLASKYLPSVNAQAEYLKTHPGARVMIAGHTDERGSREYNVALGERRADTVAEILRMAGVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFIYEATR
Research Area Others
Source E.coli
Gene Names pal
Expression Region 22-176aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 32.8kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Very strongly associated with the peptidoglycan.
Subcellular Location Cell outer membrane, Lipid-anchor
Protein Families OmpA family, Pal subfamily

Related Products

pal Antibodies

pal Antibodies for Legionella pneumophila

pal Proteins

pal Proteins for Legionella pneumophila

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.