Home
Protein
Recombinant Proteins
Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal)

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal)

^{In Stock}

Code	CSB-EP340792LNY
Abbreviation	Recombinant Legionella pneumophila pal protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

pal

Uniprot No.

P26493

Research Area

Others

Alternative Names

pal; pplA; Peptidoglycan-associated lipoprotein; PAL; 19 kDa surface antigen; PPL

Species

Legionella pneumophila

Source

E.coli

Expression Region

22-176aa

Target Protein Sequence

CSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEPGESYTTQAPHNQLYLFAYDDSTLASKYLPSVNAQAEYLKTHPGARVMIAGHTDERGSREYNVALGERRADTVAEILRMAGVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFIYEATR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

20.8kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

In the general approach to express the recombinant Legionella pneumophila pal protein, a plasmid encoding the Legionella pneumophila pal protein (22-176aa) is first constructed. The constructed plasmid is then introduced into e.coli cells. Plasmid-containing e.coli cells are screened and cultured under conditions that induce the protein expression. The protein is fused with a N-terminal 6xHis tag. Lysing the cultured cells and purifying the resulting recombinant pal protein through affinity purification. The SDS-PAGE analysis is conducted to confirm the presence of the recombinant pal protein and assess its purity. Its purity is over 90%.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Part of the Tol-Pal system, which plays a role in outer membrane invagination during cell division and is important for maintaining outer membrane integrity. Very strongly associated with the peptidoglycan.

Subcellular Location

Cell outer membrane; Lipid-anchor.

Protein Families

OmpA family, Pal subfamily

Promotions