Recombinant Pig Complement C5a anaphylatoxin(C5)

In Stock
Code CSB-YP003995PI
Product Type Recombinant Protein
Size US$2959Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P01032
Relevance Derived from proteolytic degradation of complent C5, C5 anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP003995PI could indicate that this peptide derived from Yeast-expressed Sus scrofa (Pig) C5.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP003995PI could indicate that this peptide derived from Yeast-expressed Sus scrofa (Pig) C5.
Storage Buffer Tris-based buffer,50% glycerol
Species Sus scrofa (Pig)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MLQKKIEEEAAKYKYAMLKKCCYDGAYRNDDETCEERAARIKIGPKCVKAFKDCCYIANQVRAEQSHKNIQLGR
Research Area Others
Source Yeast
Gene Names C5
Protein Names Recommended name: Complement C5a anaphylatoxin
Expression Region 1-74aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 10.6kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Derived from proteolytic degradation of complement C5, C5 anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chemokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.
Subcellular Location Secreted
Database Links

STRING: 9823.ENSSSCP00000005908

UniGene: Ssc.21108

Related Products

C5 Antibodies

C5 Antibodies for Pig

C5 Proteins

C5 Proteins for Sus scrofa (Pig)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.