Recombinant Pig Complement C5a anaphylatoxin (C5)

In Stock
Code CSB-YP003995PI
Abbreviation Recombinant Pig Complement C5a anaphylatoxin protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP003995PI could indicate that this peptide derived from Yeast-expressed Sus scrofa (Pig) C5.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP003995PI could indicate that this peptide derived from Yeast-expressed Sus scrofa (Pig) C5.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
C5; Complement C5a anaphylatoxin
Species
Sus scrofa (Pig)
Source
Yeast
Expression Region
1-74aa
Target Protein Sequence
MLQKKIEEEAAKYKYAMLKKCCYDGAYRNDDETCEERAARIKIGPKCVKAFKDCCYIANQVRAEQSHKNIQLGR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
10.6kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

In the process of producing the recombinant pig Complement C5a anaphylatoxin (C5), yeast cells are transfected with a DNA expression vector containing the gene for the C5 protein (1-74aa) along with the N-terminal 6xHis-tag gene. Subsequent culturing induces the expression of the intended protein. The recombinant pig C5 protein is then collected and purified from the cell lysate through affinity purification, displaying a purity exceeding 90%, as verified by SDS-PAGE.

Complement C5a anaphylatoxin is a crucial protein involved in the inflammatory response and immune system regulation. It is generated by the cleavage of complement component C5. C5a plays diverse roles in various biological functions, extending beyond its classical role as an anaphylatoxin. It has been shown to have adverse effects on survival in sepsis and is implicated in critical illness-induced organ dysfunction [1][2][3][4]. Additionally, C5a has been demonstrated to exacerbate anaphylaxis and amplify mast cell activities, further underlining its significant role in immune responses [5][6]. C5a exerts neuroprotective effects and may have multiple effects relevant to neuronal survival [7].

Research has shown that C5a functions as a master switch for the pH balance in neutrophils, exerting fundamental immune metabolic effects and contributing to the overwhelming inflammatory response in sepsis [8]. Evidence has revealed that C5 blockade synergistically protects against lung cancer growth and metastasis [9]. Moreover, C5a exerts its role by binding to its receptor, CD88, after central nervous system injury, highlighting its involvement in the response to spinal cord injuries [10].

References:
[1] D. Rittirsch, M. Flierl, B. Nadeau, D. Day, M. Huber‐Lang, C. Mackayet al., Functional roles for c5a receptors in sepsis, Nature Medicine, vol. 14, no. 5, p. 551-557, 2008. https://doi.org/10.1038/nm1753
[2] A. Wood, A. Vassallo, C. Summers, E. Chilvers, & A. Morris, C5a anaphylatoxin and its role in critical illness‐induced organ dysfunction, European Journal of Clinical Investigation, vol. 48, no. 12, 2018. https://doi.org/10.1111/eci.13028
[3] R. O’Brien, N. Lynam‐Lennon, & M. Olcina, Thinking inside the box: intracellular roles for complement system proteins come into focus, British Journal of Cancer, vol. 128, no. 2, p. 165-167, 2023. https://doi.org/10.1038/s41416-022-02116-7
[4] P. Ward, Role of the complement in experimental sepsis, Journal of Leukocyte Biology, vol. 83, no. 3, p. 467-470, 2007. https://doi.org/10.1189/jlb.0607376
[5] M. Yasuda, Y. Tanaka, K. Bando, S. Sugawara, & K. Mizuta, Lipopolysaccharide priming exacerbates anaphylatoxin c5a-induced anaphylaxis in mice, Biological and Pharmaceutical Bulletin, vol. 46, no. 3, p. 432-439, 2023. https://doi.org/10.1248/bpb.b22-00766
[6] P. West, R. Bahri, K. Garcia-Rodriguez, G. Sweetland, G. Wileman, Á. Monteroet al., Interleukin-33 amplifies human mast cell activities induced by complement anaphylatoxins, Frontiers in Immunology, vol. 11, 2021. https://doi.org/10.3389/fimmu.2020.615236
[7] P. Mukherjee and G. Pasinetti, Complement anaphylatoxin c5a neuroprotects through mitogen‐activated protein kinase‐dependent inhibition of caspase 3, Journal of Neurochemistry, vol. 77, no. 1, p. 43-49, 2001. https://doi.org/10.1046/j.1471-4159.2001.00167.x
[8] S. Denk, M. Neher, D. Messerer, R. Wiegner, B. Nilsson, D. Rittirschet al., Complement c5a functions as a master switch for the ph balance in neutrophils exerting fundamental immunometabolic effects, The Journal of Immunology, vol. 198, no. 12, p. 4846-4854, 2017. https://doi.org/10.4049/jimmunol.1700393
[9] D. Ajona, S. Ortiz‐Espinosa, H. Moreno, T. Lozano, M. Pajares, J. Agorretaet al., A combined pd-1/c5a blockade synergistically protects against lung cancer growth and metastasis, Cancer Discovery, vol. 7, no. 7, p. 694-703, 2017. https://doi.org/10.1158/2159-8290.cd-16-1184
[10] Q. Guo, J. Cheng, H. Zhang, J. Zhang, B. Su, C. Bianet al., Expressions of c5a and its receptor cd88 after spinal cord injury in c3‐deficient mice, Scandinavian Journal of Immunology, vol. 77, no. 4, p. 224-229, 2013. https://doi.org/10.1111/sji.12001

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Derived from proteolytic degradation of complement C5, C5a anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chemokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.
Subcellular Location
Secreted.
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*