Recombinant Pig Epididymal secretory glutathione peroxidase(GPX5)

Code CSB-EP009870PIb3
Product Type Recombinant Protein
Size US$2466
Uniprot No. O18994
Relevance May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids. Since the purified porcine enzyme has very little activity towards hydrogen peroxide or organic hydroperoxides the protective effect is not likely to be exerted by its enzymatic activity. Instead, may protect sperm from premature acrosome reaction in the epididymis by binding to lipid peroxides, which might otherwise interact with phospholipase A2 and induce the acrosome reaction.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Epididymis-specific glutathione peroxidase-like protein Short name: EGLP Glutathione peroxidase 5 Short name: GPx-5 Short name: GSHPx-
Species Sus scrofa (Pig)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence NSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQYAGKHVLFVNVATYCGLTAQYPELNTLQEELKPFGLVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELIGSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRWVHETPISTVKSDILAYLKQFKTE
Research Area Signal Transduction
Source E.coli
Gene Names GPX5
Expression Region 22-219aa
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Mol. Weight 42.6kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids. Since the purified porcine enzyme has very little activity towards hydrogen peroxide or organic hydroperoxides the protective effect is not likely to be exerted by its enzymatic activity. Instead, may protect sperm from premature acrosome reaction in the epididymis by binding to lipid peroxides, which might otherwise interact with phospholipase A2 and induce the acrosome reaction.
Subcellular Location Secreted
Protein Families Glutathione peroxidase family
Tissue Specificity Proximal caput epididymis.
Database Links

KEGG: ssc:396920

STRING: 9823.ENSSSCP00000001283

UniGene: Ssc.14513

Pathway Th17 cell differentiation

Related Products

GPX5 Antibodies

GPX5 Antibodies for Pig

GPX5 Antibodies for Sus scrofa (Pig)

GPX5 Proteins

GPX5 Proteins for Sus scrofa (Pig)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.