Recombinant Pig Erythropoietin(EPO)

Code CSB-MP007743PI
Product Type Recombinant Protein
Size US$1232
Uniprot No. P49157
Relevance Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Sus scrofa (Pig)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence APPRLICDSRVLERYILEAKEGENATMGCAESCSFSENITVPDTKVNFYAWKRMEVQQQAMEVWQGLALLSEAILQGQALLANSSQPSEALQLHVDKAVSGLRSLTSLLRALGAQKEAIPLPDASPSSATPLRTFAVDTLCKLFRNYSNFLRGKLTLYTGEACRRRDR
Research Area Others
Source Mammalian cell
Gene Names EPO
Expression Region 27-194aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 22.6kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3.
Subcellular Location Secreted
Protein Families EPO/TPO family
Tissue Specificity Produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals.
Database Links

KEGG: ssc:397249

STRING: 9823.ENSSSCP00000008194

UniGene: Ssc.15896

Pathway HIF-1 signaling pathway
Jak-STAT signaling pathway
PI3K-Akt signaling pathway
Hematopoietic cell lineage

Related Products

EPO Antibodies

EPO Antibodies for Sus scrofa (Pig)

EPO Proteins

EPO Proteins for Sus scrofa (Pig)

EPO ELISA Kit

EPO ELISA Kit for Sus scrofa (Pig)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.